SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098049 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098049
Domain Number 1 Region: 361-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-52
Family SPRY domain 0.00041
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily RING/U-box 1.65e-21
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 137-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000275
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098049   Gene: ENSDARG00000074360   Transcript: ENSDART00000112220
Sequence length 541
Comment pep:known chromosome:Zv9:23:5786107:5793448:1 gene:ENSDARG00000074360 transcript:ENSDART00000112220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVRFSLEEFMCPVCLDLLKDPVTIPCGHSYCKTCITGCWDQEDDKRVYSCPQCREAFN
PRPALAKNTILAEMVEKLKTKPPADCYAGAGDVQCDVCTGIKYKAIKSCLVCQESYCRTH
FDRHEEFHSRKPHKVIDARERLQDMICRKHEKELEMYCITDQMCICLMCKEYEHKNHETM
STAAQRTEKQKELKETQMKLQQRVQQRQKDLQQLREAVESQKRCAQTAVEDTDRIFTEII
RLIERRRSELTQMIRDQQKTAVSEAEGLMKRLEKEIDHLRRRGAELEQLSHTQDHIHFLQ
SFQSLSAPPESTDVSFNPLLSFDDLKESVQQLKVKLEDFCKEEIRKTSDKDTFANIVPKT
TRDFLKYYSRFTLDLNTVNKYLCLSSNMITYTNTPQPYPDHPDRFDQLCQVLCRESVSGR
CYWEIKWSGYGVCISVSYKGIRRKGQSKDCIFGGNDQSWCLFCYPGDHSFIHNDLKTVLP
VQSISSRVGVYVDHSAGILSFYSVSNTMTLIHKVQTTFTQPLYPGFNVSTNTHMSLCHCT
F
Download sequence
Identical sequences ENSDARP00000098049 ENSDARP00000098049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]