SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098378 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098378
Domain Number 1 Region: 497-583
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000621
Family F-box domain 0.005
Further Details:      
 
Domain Number 2 Region: 3-74
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000104
Family PHD domain 0.033
Further Details:      
 
Domain Number 3 Region: 561-628
Classification Level Classification E-value
Superfamily RNI-like 0.00000392
Family Cyclin A/CDK2-associated p19, Skp2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098378   Gene: ENSDARG00000076929   Transcript: ENSDART00000113504
Sequence length 637
Comment pep:known chromosome:Zv9:19:49818040:49821123:1 gene:ENSDARG00000076929 transcript:ENSDART00000113504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVLPHTAVCFACGEAGKEDTVESEEEKFSLSLMECTICNEIIHPSCLKMGKSEGIINDEI
PNCWECPKCHKEGKTSKDQTDGLGKRRMDNGEVSRWKLTDEPPASKKKSLSVEDAPRSDG
PKRKKEKELPQDSGSKKKIKGAREKHLKKKVKPNSSDSSEANGPNSSSGGGHGSGTAAAS
ALLSASQDQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSSESDSESDSDSPSP
IAASEPSSPAYGGSARERNRRLAELGFSASEESEGESVAEVEVEGVEEPQRRRGDGARVR
RAALEPEPEEEEEGVGDHRAAPAAPASPQPNTQTPPFTHTHSTGTDGLPSSKRTNGQDAR
NGRTRVGREQQEKENAHSSAAPNHRHVKPARGSKMRGGGRQGQSAASGKSSSAAVSSGTA
NGSTGFTNPAPLAGASLASHRSQQPRVVPPRSQLVKRSSVPVPSPPRPLQMERHLVRPPP
ACPEPHCLPLDSGATHVLPRDVWLRVFQHLNQRQLCVCMRVCRTWSRWCCDKRLWTRIDL
SRQRSITPPMLSSIIRRQPVALNLGFTNISKKQLMWLINRLQGLLELNLSGCSWSSVSAL
CQSVCPCLRLLDLSRVEDLKDSHLKELLAPPSNDTRS
Download sequence
Identical sequences F1QGR4
ENSDARP00000098378 ENSDARP00000098378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]