SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098413 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098413
Domain Number 1 Region: 180-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.07e-57
Family Voltage-gated potassium channels 0.00088
Further Details:      
 
Domain Number 2 Region: 39-143
Classification Level Classification E-value
Superfamily POZ domain 4.04e-32
Family Tetramerization domain of potassium channels 0.00000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098413   Gene: ENSDARG00000074746   Transcript: ENSDART00000114765
Sequence length 632
Comment pep:known chromosome:Zv9:8:10412697:10531811:1 gene:ENSDARG00000074746 transcript:ENSDART00000114765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVATWLPFARAAAVGWLPLAKKTMPKPPIDKKNRNDEILFVNVSGLRFQTWKNTLDR
YPDTLLGSSEKEFFYNEDTQEYFFDRDPEMFRHILNFYRTGRLHYPRQECIQAFDEELAF
YGIVPDIIGDCCMEEYRDRKKENQERLAVDTEAEMATDTPLPPHSTHRERLWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCRPLKGSKKDLPCGEKYSLAFFCMDTACVLIF
TFEYLMRLFAAPSRCKFMRSVMSVIDVVAIMPYYIGLVMPENEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTKGTNFTSIPAS
FWYTIVTMTTLGYGDMVPNTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KMRAQQKVRLARIRLAKKGTTNAFLQYKEEGGFHDRDHDGALCLKNRSSFEHQHHHLLHC
LEKTTNHEFTDELTFSEMCMTESVGYRTSRSTSISSQQGVSTSCCPRRAKRRAIRLANST
VSVSRGSVQELDTLHVHKTTIRPQSRSSLNARTEDLKLNCDDRDFTAAIISIPTPPANTP
DESLPPSPAIPGILRNSRSSSFTHETVKISSL
Download sequence
Identical sequences B0UYF4
7955.ENSDARP00000098413 ENSDARP00000098413 NP_001119942.1.45394 XP_005166764.1.45394 XP_017212747.1.45394 ENSDARP00000098413 ENSDARP00000120299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]