SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098566 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098566
Domain Number 1 Region: 183-452
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-80
Family Nuclear receptor ligand-binding domain 0.00000000375
Further Details:      
 
Domain Number 2 Region: 130-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-30
Family Nuclear receptor 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098566   Gene: ENSDARG00000004697   Transcript: ENSDART00000110950
Sequence length 458
Comment pep:known chromosome:Zv9:20:33928593:33944223:1 gene:ENSDARG00000004697 transcript:ENSDART00000110950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDIFHLFILLLHFYSSPLNSSPSQPPVMSSMVGHPSVISSSRPLPSPMSTLGSSMNGLPS
PYSVITPSLSSPSISLPSTPSMGFNTLNSPQLNSNKNIMNGNEDIKPPPGLAPLGNMSSY
QCTSPGSLSKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYTCRDIKECLIDKR
QRNRCQYCRYQKCLAMGMKREAVQEERQRGKEKSDTEVETTSRFNEDMPVDKILDAELSV
EPKTETYTESSPSNSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLPLDDQVILLRAGW
NELLIASFSHRSITVKDGILLGTGLHVHRSSAHSAGVGSIFNRVLTELVSKMKDMQMDKT
ELGCLRAIVLFNPDAKGLSNSLEVEALREKVYASLETYTKQKYPDQPGRRFAKLLLRLPA
LRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQIT
Download sequence
Identical sequences ENSDARP00000098566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]