SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098579 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098579
Domain Number 1 Region: 387-652
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.49e-62
Family Extended AAA-ATPase domain 0.00000191
Further Details:      
 
Domain Number 2 Region: 924-1055
Classification Level Classification E-value
Superfamily Bromodomain 4.97e-28
Family Bromodomain 0.00089
Further Details:      
 
Domain Number 3 Region: 748-900,928-988
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000177
Family Extended AAA-ATPase domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098579   Gene: ENSDARG00000076590   Transcript: ENSDART00000111963
Sequence length 1358
Comment pep:known chromosome:Zv9:16:46270515:46287081:1 gene:ENSDARG00000076590 transcript:ENSDART00000111963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMLRSNGDMDSSSEFLSLNPPKRKSARLKKANDDSLTSAEDSPANEENSMRSRAQRGRH
VAFADMNGQTSKSPPKEEKSGKHLRKSPRLQADGERSADEHTDEVDSTPTSRNLRARIQR
RGEDDSAVRRSSRITRYKLDTRKQSVLYDRLITNTAEAVLQKMDDMQKMRRRLRSRDSEE
EKLRIYSGTKRTRITKPSVRGQEESSDNQENEYSDQDEEEEEEEDGEGEEEENDEGDADE
DEDEDEEDNGKRYDFRQRKAVVRYQAPLEEPKKQSIFFKRHSTPLRRSYPFSSSSPRRPY
NNRRSTSSRWSEGDGRRHAIHSSDSTSSSSSDEEKFERRRTKSRNRSINRCLPMNLRKDD
LLGIHKDRIKIGASLADVDPMQIDQTVRFDSIGGLGKHISALKEMVVFPLLYPEVFEKFK
IQPPRGCLFYGPPGTGKTLVARALANECSQGERKVAFFMRKGADCLSKWVGESERQLRLL
FDQAYQMRPSIIFFDEIDGIAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEVVVIGATNR
LDSIDPALRRPGRFDREFLFNLPDREARKDILKIHTRHWDPQLSDAFLEELADKCVGYCG
TDIKAVCAEAALCALRRRYPQIYASSQKLLLDVESICVSGRDFLSAMRKIVPASQRAVVS
PAKALTPVIEPLLSAALNNAMKMLQRLFPHVEQGLKKKRDTGNVSGILDDLLQSEDEGSS
VCITNKGQKNTGPAVSVLHLTRSALQQPTSFRPRLLLCGTSGSAQTSHLAPAILHTLEKF
TVYTLDVAVLYGVSSATPEEACAQVFCEARRTAPSIVYIPHIQRWWDTVSPTLRATFISL
LQDIPSFCPCLLLATCSFPHDALYTEVQDLFHVEYGEVFDVPLPSRDERLRFFEDLILNQ
AAKAPASKREAVLQALEVLPVAPPPPPRLLTKQELQKLEEQEEDTLRELRLFLRDVTNRL
AQDKRFKAFTKPVDTEEVPDYTTVIKQPMDLSTVLSKIDLHKYETVAAYLEDVDLIWQNA
LEYNPDRDPSDRLIRHRACALKDTVHAIIRDELDEDFEKICVEMKESRSKRGSSSSRFTP
AYYHVLPKVSATAEQKTSDPTPSKEATPLSAQAVISPRQAGINTASQMKKKRKNRWKNGF
ISKKKCSHVNSKDNSNIAESGDEEEDEDEDGKPAESEDLEKMRDAECETMEVEGPTTSTS
VVQKITFVSEEQEDNTAAAVNEVVNVENVQINASGEQNDVQPLDNNEPKRTEPGAEDDTE
MEFRPRRLTRGFKSQAEQQSLISVDAAMKILEQKNVPLIVDHNKLKELLQKVVDMTEGYE
VNQLEKLYALLCQSIYRHRKDYDKTALIQACLDAKALG
Download sequence
Identical sequences ENSDARP00000098579 ENSDARP00000098579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]