SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098594 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098594
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.74e-26
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000098594
Domain Number - Region: 392-441
Classification Level Classification E-value
Superfamily YbjQ-like 0.000144
Family YbjQ-like 0.0063
Further Details:      
 
Domain Number - Region: 932-1026
Classification Level Classification E-value
Superfamily YbjQ-like 0.000746
Family YbjQ-like 0.0077
Further Details:      
 
Domain Number - Region: 210-248
Classification Level Classification E-value
Superfamily YbjQ-like 0.0562
Family YbjQ-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098594   Gene: ENSDARG00000094590   Transcript: ENSDART00000110354
Sequence length 1055
Comment pep:known chromosome:Zv9:18:5727336:5788671:1 gene:ENSDARG00000094590 transcript:ENSDART00000110354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKLKAKIVAGRHLPVMDRASDLTDAFVEVKFGNTTYKTDVYPKSLNPQWNSEWFKFEV
DDEDLQDEPLQITVLDHDTYSANDAIGKVYIDIDPLLCSEAATVISGWLPIYDTIHGIRG
EINVLVKVDLFNDLNRFRQSSCGVKFFCTTSIPRCYRAIMVHGFVEELVVNEDPEYQWID
RIRTPRASNEARQRLIFLMSVGELQRKIGLKVLEMGGNAVVGYLQCFDLEGESGLVVRAI
GTACTLEKISTLPSTATHQSNSSPSKDMKEPVFGEEVPGIPLSSGPPTPLRAQTFSSFSP
SKSYSRQSSSSDTELSLTPKTGMGSGGSAGKEAGPLKALLRQQTQSALEQREYPFFTLTS
FPSGFLLHVGGVVSARSVKLLDRIHNPDEPETRDAWWEEIRQEIKSHAKALGCHAVVGYS
ESTSICEEVCILSASGTAAILSSRFMQDGPLDTEHRLEEVVPPGCGFCHIPYDELNIPFP
AQLTYCYSCRRSKVPDVLFTTIDLPADANITGKGCLIQARLCRTKKKAQGEGNATAISNL
LPFLEYELHTQLMNKLKLRGMNALFGLRIQISVGETMLLGLASATGVYLTALPGPGGIQI
AGKTPSDITYEQHISNMQKKINDTIAKNKDLYEINPPEVVEEIIGSPIPEPRQRSRLFRS
QSESSDEVSELDLSHGKKDAFVLEIDDTDAVEDIHALLTDSPTPQGFYSCNTEIMPGIQN
WTSAIQMFTSVRVFRLNNANLTNQGLNKIFSDLCENLLKSLYFKLRSMVPCCLCHLNFTV
AIPEDELIQVAVTAVAMSFDKEQILENGKQSGEKTLTKAITENDEQLQFNLELNPESSHA
NPLSSPKGNVSCLSEVGSHPSARAPSVDYSSFADRCSSWIEQLRLKAHTIRRGSVKTTSS
MEKASPLPEGRSRSLRSNRSYSGTSVAVVKMTPLSFIPGAKIIKYLGIINMFFIRETTSL
REEGGVSGFLHSFIAEVFAMVRAHVAALGGNAVVSYSMKECVFMENPNKNQQAQCLINVS
GDAVIFVRESELEAASVQPQSTTHTSNGGEGTVIS
Download sequence
Identical sequences ENSDARP00000098594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]