SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098809 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098809
Domain Number 1 Region: 572-752
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.0000805
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000098809
Domain Number - Region: 434-557
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.049
Family PLC-like (P variant) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098809   Gene: ENSDARG00000077440   Transcript: ENSDART00000114996
Sequence length 944
Comment pep:known chromosome:Zv9:12:49873400:49914803:1 gene:ENSDARG00000077440 transcript:ENSDART00000114996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPLLRRTFSKLRAKERFRRKTDPKLTDVTGKVDLFQTPSSTETESGSAEDQTRRSQIT
VSKKQNWAKLPTACREPDPCSSLVYGPPDWDLCSEKADKQAWSQRTLSEDGLKRKRNDLE
LEFGYSRTAVDAGLPELTPPSTTYMDVCVSSSSAKISGQGAYLQHLDRSSRAWVLSTGKP
QTPDETLPTRITEWRQGPEREGNIWYNPIPEEDDVRPGVGAGQEGYGDPWRKREIEGFAK
EERETSKKTGGLSGPGIQGEADVSGADSLDLVLPSDSISAAVSDSPGTQKKAPAESSSSV
MDRIKSPGTVRRLSMKMKKLPELRRKLSLRSSRNQQRHGASASSTHTPSDDASPTNTRKE
SSNVISRYHLDSSAPARPTRRSSRSASKGGYLSDGDSPELLPKGSPTPQESLSVADAESF
RLYSLADQPRCAQRLSGLLTVHLLGVEELLRANKASKEVFCAIQVDGVTRARTSLLTCRG
ACLPLNHTFNLELERARLLKLVILTPATANASSAPARNRVCCVGAVAIPALFKACRSQHL
CVRLEPRGLLYVKLTLLEQFVSPFPRPGDLPPPAVFGVELRPLVEKESTALRVPLIIQKC
VSEIQRRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVTLNEELYPDVNVITGILKDYLR
ELPSPLITRTLYEVVLEAMTVRPAYRNDSDAQKSQSTVSLLHCLPEPERATLCFLLDHLS
LVASYSDSNRMTCQNLAVCFGPVLLTPSQECWQAGLSAPACGGVLPGSGASRGGRSFAHS
EEINSAVDFKRHIEALHYLLQLWPVPTNGVLEDCDQPQASHNASVRLCQRAPLHVDLPPA
QEVVVSRRGRGRLESPPCNRYAGDWSVCGRDFLSNDEADYDEVAGSESDEEKKQEVWTTA
DGLYMDDFTLDFDAPFTCRLSLKDFDTLISDLERELAKQINICL
Download sequence
Identical sequences ENSDARP00000098809 XP_696571.6.45394 ENSDARP00000098809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]