SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098939 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098939
Domain Number 1 Region: 49-143
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.4e-28
Family Hormone receptor domain 0.0000723
Further Details:      
 
Domain Number 2 Region: 122-402
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000568
Family Rhodopsin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098939   Gene: ENSDARG00000003989   Transcript: ENSDART00000111751
Sequence length 431
Comment pep:known chromosome:Zv9:3:21953582:22094901:1 gene:ENSDARG00000003989 transcript:ENSDART00000111751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSFFVPPLQVLTIWITLISRATADLTCDALLLLSTNLTARTLILWNQTSSPTTNSTGLFC
NTSIDGIGTCWPRSSAGEVVSRPCPESFLGVRYNTTNNVYRECLANGTWAKKGNYSQCQE
ILNEEKKSKLHYHIAVIINYLGHCISLGALLVAFILFMRLRSIRCLRNIIHWNLITAFIL
RNATWFVVQLTMNPEVHESNVIWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTD
KLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKRAGIYTDYIYQGPMILVLLINF
IFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEISQIVF
IYFNSFLESFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHSIRARVARAMSIPTSPTRV
SFHSIKQSSAV
Download sequence
Identical sequences ENSDARP00000098939 7955.ENSDARP00000098939 ENSDARP00000098939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]