SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099086 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000099086
Domain Number 1 Region: 487-550
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000903
Family F-box domain 0.0042
Further Details:      
 
Domain Number 2 Region: 577-755
Classification Level Classification E-value
Superfamily RNI-like 0.000000114
Family Cyclin A/CDK2-associated p19, Skp2 0.036
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000099086
Domain Number - Region: 7-40
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0883
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099086   Gene: ENSDARG00000078908   Transcript: ENSDART00000113650
Sequence length 805
Comment pep:known chromosome:Zv9:1:42072922:42137659:1 gene:ENSDARG00000078908 transcript:ENSDART00000113650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLDLPYRCPRCGEHKRFRSLSSLRAHLEYNHTYETLYVLSKSNSVCDAAALLPLVADG
ALTAESRFPYRELPCSGEELGLAPSSTACYLPNVEFPLGEILVKTAMSSSDALSSAGNNA
VAVAANVAASAVEAAYEEGLARLKARAFERLELDERLEKLSEEVEQKISARVSRLQAELE
RKSSELEKAKLESERLSQEKQDLEDKATELSRQVDVSVEMLASLKQDLVNKEQELSHKQQ
EVSQIDQFLQETAAREANAKLRLQQFIEELLDRADRAEKQLQIISNCGTTPNGSLGHCSL
GSKSNGRQRNSSLSGVSRGMYQVSDRRSSPSTAASVRGKSVSQGSGGYDSDSVDLHALED
CPDAQYYHVQCRLGEGGGAGYERAAASRSWGLRKQAIQNWQRRPYRNSMEGEEGDVSDVG
SRTTESEAEMWEQDRRADSSQHAGHRGGYRLPTGRSEGGYKACRHEKSPSKGSEVISPEV
LKMRAALFCIFTYLDTKTLLRAAEVCRDWRSVARHPAVWTRVLLENARICSKFLCTLSQW
CTQTHSLILQNLKPRQRGKKETKEEYLKSTRGCLEEGLEALLKGTGSNLLILKVSHCPNL
LTDRSLWLASCYCRALQAVTYRSATDPVGQEVIWALGAGCRDIISLQVAPLHPCQQPARF
SNRCLQTIGRCWPHLRALGVGGAGCGIQGLASLARNCMRLQVLELDHVSEINQEVAAEMC
REGLKGLEMLVLTSTPVTPKALLHFNSVCRNLKSIVVQIGIEDYFEDPNSPEARKLFDEM
VNKLQALKKRPGFSKILHVKADGLC
Download sequence
Identical sequences F6NUQ2
ENSDARP00000099086 XP_696198.4.45394 ENSDARP00000099086 ENSDARP00000122575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]