SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099452 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000099452
Domain Number 1 Region: 69-292
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.43e-57
Family BAR domain 0.0028
Further Details:      
 
Domain Number 2 Region: 303-496
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 30-68
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000567
Family Chromo domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099452   Gene: ENSDARG00000070804   Transcript: ENSDART00000109003
Sequence length 797
Comment pep:known chromosome:Zv9:3:18296653:18473426:1 gene:ENSDARG00000070804 transcript:ENSDART00000109003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLRIEYYGLSRIIQAEAERGKNSCEVEVNMELSAVGERVFAAESIIKRRIRRGRMEYL
VKWKGWSQKAEKTEVLSDDLLLIERRLENVRLVSHNVHKKMVMCLQGNVGTDAEKRHKKL
PLMILSQSMVEGVAQLGEESLIGKMMDICGDAENKLAFEQSQHEVLLEKDILDPLNQLAE
VDIPNIQKQRRHLAKLVLDYDSAKGRYHQATKSFPSATNAQAMAAKVDMLKEEMDEAQNR
MEICKDQVAADMYSFASKEGEYARYYVLLLEAQAEYHRRALASIESVLPNIQSQQDKWME
KPAFGTALEEHLKRTGREVALPIEACVMMLLETGMQEEGLFRIAAGASKLKKLKAALDCS
TSQLEEFYSDPHAVAGALKSYLRELPEPLMSYQLYEEWIQASNISDPDKRLQALWVVCDM
LPKANKTNFRYLVKFLAKLALESDVNKMTASNIAIVLGPNLLWAKTEGSLAEMAATTSVH
VVSIIELIINHAGWFFPGDVDFNVSGVFAMPGCPGTPDVEYGTIERRRPGSQGSLDSDTA
RKDSPANKQPEFAPRRTGTITKKQHSTPNFQPPLPPIEAGGGSAFESCPQLPAAGLEALQ
TQQTLVQQSPASDNSSLSSRDSVSTPPTMRNGPGGSSGTPAPAQLSVGTPTSSPKGPSPF
MVRRGTKKQAPAPPKPSVPATSPSVKATPNQPISNPYSTPGTPQPLIAPRRTNQTPIQAP
SHPPPQPPSQPPSHTEEAVPSPPRTPTPPGTPPHDSSQSRPRPTPRSRPKPSGPPPPQPA
DGANGVCVSASKIISDV
Download sequence
Identical sequences ENSDARP00000099452 ENSDARP00000099452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]