SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099538 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000099538
Domain Number - Region: 331-375
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0659
Family Chromo domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099538   Gene: ENSDARG00000074780   Transcript: ENSDART00000109212
Sequence length 376
Comment pep:known scaffold:Zv9:Zv9_scaffold3554:274711:281870:-1 gene:ENSDARG00000074780 transcript:ENSDART00000109212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERMKKPKQKPCHNCGALNVSNCKTCRNCFAAIALKAIIMAKQKNIEESSWAANNKKHRNS
ARVVDSARTAVKKLEMLGYKPLLFISKEKKKGFNTELITTMGPFGEGPQQKIIDKMASLY
EVFIKNFQRFQNSAATDPDVCQNLASSVSPPASIPPSSSSSLPPPPSFPNLSPPQTSSSF
PPSFAVPPPSLPNLSPPQSSFSFPPSSAVPPPSFPNLPPPQSSSSFPPSSAPPPLSSNLI
PPTNSSSFSPPTSSYITPLPPASSYKTLPAPPPTSLTTTPTSSLSSPAVQCMTTDFGDSA
DLFSRESIIKGDKQKKWIYKQAECQVHSNQKTFPYDRIVKRRMSKEGVEEARVRWKPCSG
CGMKWKDSWEPSNHFL
Download sequence
Identical sequences ENSDARP00000099538 ENSDARP00000099538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]