SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099875 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000099875
Domain Number 1 Region: 15-159
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.82e-27
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 
Domain Number 2 Region: 440-472
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.00000000000837
Family Eferin C-derminal domain-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099875   Gene: ENSDARG00000075596   Transcript: ENSDART00000112620
Sequence length 483
Comment pep:known chromosome:Zv9:13:19745290:19767798:-1 gene:ENSDARG00000075596 transcript:ENSDART00000112620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGEQSQKWFPTHVQATVLQATDLQPKGKNGTNDAYTIIQLGKEKYSTSVAEKTLNPAW
REEASFELPGLLMESNPEVYELCLTVMHRSLVGLDKFLGQKLINLNEIFDNKERRKTDWY
TLDSRPGKKRKDRGKIQVSIQFMRNNMTASMFDLSMRDKPRSPFSKLKEKMKGRKHDGAF
SDTSSAILPRSGQSETDSLADQHPHSHPQAPTEPKPKRSLLTGTQKLSAAHSMSDLIGTH
FRNKLDSMNSIEEKEQQTCIKLPTRRCRGASSHRHSQSDGYGCPASDVQCDPFSDIGDNM
PQKFATLPRNRNPFEGDQGTLWGADKKEKKEKVGLLGRVTGKKDGKKTGARIGSSGDLRS
PNPFTSESTSETNPFLSHYRSSSNFILNSDNMKNPTSNEDLTQRFKASPEKKQTSVAAYS
NLSFEEVVQELIKQKDVVKKKDAHIRELEDYIDNLLVRVMEETPSILRTPYEPKRKAGKI
SKK
Download sequence
Identical sequences ENSDARP00000099875 ENSDARP00000099875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]