SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000100489 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000100489
Domain Number 1 Region: 617-806
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-51
Family DBL homology domain (DH-domain) 0.000000137
Further Details:      
 
Domain Number 2 Region: 810-946
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-33
Family Pleckstrin-homology domain (PH domain) 0.000000914
Further Details:      
 
Domain Number 3 Region: 320-425
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000216
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 4 Region: 118-197
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000811
Family CRAL/TRIO domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000100489
Domain Number - Region: 1036-1071
Classification Level Classification E-value
Superfamily SH3-domain 0.0053
Family SH3-domain 0.0056
Further Details:      
 
Domain Number - Region: 432-494
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0115
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000100489   Gene: ENSDARG00000079742   Transcript: ENSDART00000115255
Sequence length 1072
Comment pep:known chromosome:Zv9:11:10533584:10722703:-1 gene:ENSDARG00000079742 transcript:ENSDART00000115255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCRLEEEEEMSLLELQQRVDCIITHVDEIMQQEIRPLLAVDIIEQLHRQFALLSGGRGQ
EGSPIITFPEFSGFNEVSDEDFINVVTYLTSIPSMDAASIGFIIILDRRKDKWNSAIASL
ARIAGSFPGNLQLVLVLKPSRFLQRAIADVSMRLHRDDFKLKVPIVMLNSLSDLHGYIDK
GQLTCDLGGTLDYCHSQWIHHRTAIENFALTVKSTAQMLQQFGTDLAETELPNDVQCTKD
LLITHTEKHDKLKDELKLAVKQGNTLLSCIKDQATKAESHILNPDEVENQTTVERLLAQL
DETENAFEQFWSRHHLKLEQCLQLRHFEQDFKEVKVSLDGLSEALLGLSDTGDCVARVEQ
LLGELKTLEDKAQECLEKAQLQAQHGDQLIQSNHYAIDSIRPKCVELRRICDDFSNEAKK
KRDVLTKSLEILKRIDEVNQWCESGVYLLASQAVDRCQTQEGAEAALQDIERYMKTAKEQ
QLSHLKELNNQYEVVLSELLKSKVQTALKTLNDVQEMFEKRHASLKKLSTKQTRPVQPVA
PRPESSPKRPSPKIPHPTPPTSHRKTTDNSSTNRQPSDAELAKRKNIRKAKGGIKIEVMH
EGGQGGSSHILMNNETEESLSNRRSHIMNELIETERLYVEELQSIIEGYAAALDDPELIY
LIPPSLENKKEVLFGNLPEIYQFHQKIFLKELENSAEKPELVGTCFLKRKEELQIYEKYC
QNKPRSEALWRQCGDSMFFQECQKRLDHKLSLDAYLLKPVQRITKYQLMLKEMLKCSKNP
EGTAELEEAQATVLDIIKSVNDSMHQIAITGFEGSLNDLGKLLMQGSFNVWTDHKKGHSK
VKDLARFKPMQRHLFLYHKMILFCKKREEMTDGHEKSPSYSFKHSLKMGSVGITENVKGD
IKKFEIWYNGREEVYIIQAPSMDVKNTWVSEIRKVLTSQLEACREASQLHQKITENIYHA
PMRNMRKTALRQSDSSSPETGYRRSDSGPNMRQKRGWSQRRLPSMDAEDFETIPSSAEEL
SISSDGEDEGHNKNGDNDRYQVQLTYESCTAQDLSVEAGDFVQFLEESENGL
Download sequence
Identical sequences ENSDARP00000100489 ENSDARP00000100489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]