SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101239 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101239
Domain Number 1 Region: 55-167
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.81e-34
Family MBT repeat 0.0000216
Further Details:      
 
Domain Number 2 Region: 144-246
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.51e-32
Family MBT repeat 0.0000105
Further Details:      
 
Domain Number 3 Region: 656-730
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-18
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000101239
Domain Number - Region: 16-58
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0281
Family MBT repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101239   Gene: ENSDARG00000069932   Transcript: ENSDART00000115339
Sequence length 733
Comment pep:known chromosome:Zv9:16:39528909:39558781:-1 gene:ENSDARG00000069932 transcript:ENSDART00000115339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKPVPQKANEWKDGKRIKHPRSGRPPCVPSQFQGHFSWEKYLKETGAVAAPAQYFKQST
EPPENEFKAGMKLEAQDPRNTTSTCIATVVGLTGSRLRLRLDGSDNKNDFWRLVDSAEIQ
PIGNCEKNGGMLQPPLGFRLNASSWPMFLLKTLNGAEMAPARIFHKQEPPAPEQNFFEVG
MKLEAVDRKNPHFICPATVGALRGVEVLVTFDGWRGAFDYYCRYDSRDIFPVGWCTLTGD
NLQPPGTKVGLPKTLGALSALPDSGTEGTGMPPTPGRPPSQKKRKPGRKKNKLSGPWGQK
GTLGSQTSLPDKEVESIKIPKKRGPKPGSKLSWAKKTAWLEETIGGPGRPISKPRGKLPA
SWTQKVQQNPTDPIKLPKKRGPKPGVKRKPRLIPNPMPTSPSSSTPEPDTSSVPMDNATI
PKAALQAPTVCVYLNKHGNVGPHLDARRVQSLPDHFGPGRASSVLQQCVQACVDCAHNQN
TVFSCLKPGHGGELISAYFEQQQHTLTLPAVNSVTYVLRFLEKLCHNLHCDTLFGNQPVP
LGVVHYDSRMYTERRNFAESLSSGPGRGTKRFLQHDTYSSKPVPHKISKNHRLSSEEPFL
MENGVGSSDVLEKTHLSPGHSLTKRSLSQNSNSPGKLHRLGSTGSERFLSFRESPRPSGQ
DPNLWTVEDVMQFIRDIDPQLGPHADLFRKHEIDGKALLLLRSDVMMKYMGLKLGPALKL
SFHIDRLKEGHLP
Download sequence
Identical sequences A0A0R4IAY8
ENSDARP00000101239 ENSDARP00000101239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]