SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101801 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101801
Domain Number 1 Region: 366-484
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.56e-41
Family MBT repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 254-363
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.69e-38
Family MBT repeat 0.00000939
Further Details:      
 
Domain Number 3 Region: 469-594
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.47e-37
Family MBT repeat 0.0000305
Further Details:      
 
Domain Number 4 Region: 773-840
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000018
Family SAM (sterile alpha motif) domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101801   Gene: ENSDARG00000074346   Transcript: ENSDART00000110260
Sequence length 851
Comment pep:known chromosome:Zv9:16:28761351:28776676:-1 gene:ENSDARG00000074346 transcript:ENSDART00000110260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSVSDGPATGGDFDMMSALDWKDGIATLPGSDIRFRMTEFGTLEIVTEAEPKIKETELTD
PQPKITGPINRHPPDLNTTSNQTAKIQSNTDHQTSTPGNKVYTYLYNTTFRTKQSVYTSC
LLNCCAKTCGLSGSRESFLQGKFCSASCVQPSSGRSTPAEAFEGERLGKRVRKKKKMFME
SEDEEEENIEEEEERVKSSKGRRAAKVARLEWNSINLLVKLTAPLVKKKTWSWSVYLEEE
RAAAAPLKLFKEHQSFPQSRNGFKVGMKLEGLDPCHPALFCVLTVAEVQGYRIRLHFDGY
PECYDFWVNADSWDVKPPGWCEKTSLKLLLPKGCRDGEFNWNTYVKNCRGQLAPKHLFKS
LNTSVTPSGFRAGMKLEAVDRKNLSDICVATIAAAVDNRLLIHIDHCDDTHDYWCDASSP
YIHPVGYCEEVKLTLTTPAEYKHLKGFSWEKYLEETGTQAAPARAFKQRPPHGFQVGVKL
EAVDKRNPMLIRVATISDTEEHRIKIHFDGWSDEYDYWLDADSPELHPVGWCQKTGHPLQ
HPNGTRDSPVPPGQGCPTPGCNGVGHIRGPRYGTHYTAVSCPYSDLNFNKDGLVPDRLSG
ERPVTISGPPRHRRAETLTQTHQPTSSASTPEPPDTTTDACPQARPVREHVVTAAAPKCV
KAPQVKQEGDGKGTYQSDASENCLTCFAVSQISQTMTLHLHLSLTLLTAIPPAGATPTMS
HVIIKIQNSRNRFDSLQQFLHESVFCGWEQPRFQLCWEKHGKLLPEALGLTAKRVSKWNT
EEVASFVRGLPGCREHAPTFRKEQIDGEAFLLLTQSDIVKILSIKLGPALKIYNSILMLK
SADEENAKRPL
Download sequence
Identical sequences ENSDARP00000101801 ENSDARP00000101801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]