SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101927 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101927
Domain Number 1 Region: 930-1020
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-22
Family Tudor domain 0.0013
Further Details:      
 
Domain Number 2 Region: 478-572
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.29e-17
Family Tudor domain 0.0047
Further Details:      
 
Domain Number 3 Region: 678-765
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000012
Family Tudor domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101927   Gene: ENSDARG00000077523   Transcript: ENSDART00000108540
Sequence length 1091
Comment pep:known chromosome:Zv9:7:62529176:62605105:1 gene:ENSDARG00000077523 transcript:ENSDART00000108540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTGMKMADEELVKKMVRAVLQSSKSGLSLSDLQVEYKDLTGELIPYKQLGYVTLDALLH
SMPSIVKLDKGQSGEVMCHATTGNEMAHITKLAARQRTAKKTGRPQVVNCQMRVKPAAPL
VLNAKPRTSLRQPDHRGRLGRGGGRGHGDTRTGCMRDPQLDGKGGRPHNTPPNTPSRKPS
LPSERPEKRMTLPSRFQKEVHAHILRNPQHINVPSNLNENTTPPKPRLPHSAPYSPKLVQ
SRLQEVLNKHSNGLWVSKLPQLYREHYKQDLPSEALKELENWTHICTVEKPCSSKPQELL
LYPAKETSQITPTPTHDRSPSHHKKPQTQRPSLTAKSNTPESPKALSPDLKQKLGELLLK
YSSGLWAHALPKLYQDTYKCKLPEFVLDQLTLLSDICTIDYPVPDNPKRAILYAKVVEDE
NRNQSGLAGQEMKLERRLSSQTVPPLVIPRVEYPSVLVVDASDTNCVILRYIGEGYSKAQ
EKLEDEMREFYRQDNTKMALRSPSPGQLTAVGAEEEDDIIRAQVCEVMADKVKVYYVDHG
FSEVISIRKLFELNEKFYRLPFQATKCKLAGLESFSQEQAVLKKLESIATGKILLAEILE
REDMPLVVLYDTSQDDDVNINAACMKALQDRSLESPLKVNSAYMNVSVTSVCSDGTIYCQ
VPSRGLTKLNEILEKTENYFHSQVTSESLVSRPFCGKNCLARYKGKWSRVEITNLHGSRV
LDILFVDVGVQASVEVIELREIPPPLLRDLISTPAQALKCCLAGLPVSVGLWTPDAVQWL
RDTVLHISDCSLKIAKVDETKRLAHVYLFTSKNFHDTSCSLNQQLADSDLWNHQKDVFLS
SRGPLKSLNVPTATQTSSLKTDRGDKALHTPKKTSPPLGSKSTPAGSPPERLSLPPALEL
PEIGQNMDVFVSVACHPGHFVLQPWQDMYKLVVLMGEMILHYNKMEEKALKVEKNQVCAA
KVENNWYRVLVKGVLTNGLVSVFQLDYGKHELVSGTKLRPLTQEFCQLPFQAITAQLAGL
KPRQWSEEASIVFRNHVEKKPLVAQLESVQEASQPWERKVMIYLVDTSQEERDIWLHDIM
AEFTDEMTKTA
Download sequence
Identical sequences ENSDARP00000101927 ENSDARP00000101927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]