SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103132 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103132
Domain Number 1 Region: 492-659
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-39
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.71e-18
Family SAM (sterile alpha motif) domain 0.0041
Further Details:      
 
Domain Number 3 Region: 202-300
Classification Level Classification E-value
Superfamily PDZ domain-like 2.8e-16
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103132   Gene: ENSDARG00000073707   Transcript: ENSDART00000110923
Sequence length 963
Comment pep:novel chromosome:Zv9:21:24703685:24800627:-1 gene:ENSDARG00000073707 transcript:ENSDART00000110923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVMEPVSRWSTSQVVDWMKGLDDCLQQYIKNFEQEKVGGEQLLRITHQELEDLGVSRI
GHQELILEAVDLLCALNYGLETENLKTLTHKLNASAKNLQNFITGRRRGGHYDGRATRKL
PNDFLTSVVDLIAAAKSLLAWLDRSPFAAVADYSMTRNNVIQLCLELTTIVQQDGTVYET
ENKILHVCKTLSGVCDHIIALSSDPMVSQAAHLEVVQLDNIRSTEGLGMYIKSTYDGLHV
ITGTTEGSLADRCKKIHAGDEVIQVNHQTVVGWQLKNLVNSLRSNPAGVTLTLKKRPQST
LTSAPALLKNMRWKPLALQPIIPPSPSSSVATPSSTLSTPSRRDSCALQDLYIPPPPDEP
YTPRDDVGNLTSNCQQAAKGSDSPNSFLDQECRRRFPLLDEDAVLYCYEYDQTQGPPPVR
RDSTPTYGRLRPISMPVEYNWVGDYEDPAKLKKEIRRENSLLRYVSEDKTEEFHTGRRSS
RRSRRKSEKGGSPAHYALVPTLQMDMLPPDSLATPTSETSSVYLTFDRSSVLSRSKKNKL
RAGSLPSISKRRISCRDLGQGDCEGWLWKKKDAKSYFSQKWKKYWVVLKDACLYWYTNEE
DEKAEGFVSLPEFNIDQASECRKKFAFKACHPKIKSFYFAADNIEDMNRWLSLMNMAAAA
HSEQKRIRQDHDYWSESDHEDADHISSTTKQDSPPPPYDTYPHPTSVSPFQDSQHIRPPS
TETVQSRSPLSETQGGSVSSASSPGRKSASQRRSWQDLIETPLTSSGLHFLQTLPLDDSV
FVDSNRTVPVELRRQSTLPAQHGLPTEHFIPPTTPTQPSPKPIPALGRGETMDGGGIGSK
HRSFTLPRDSGLHAILAASSAAEHGDAQRYHLGHVHSRDTGGERERRHQADSLVDLYRAL
ERSSLSPVNEHRSSSRLEYKRSFVRRCNDPLLNEKLHRLRILQNSFKDIPLQEAETKIIH
RDV
Download sequence
Identical sequences E7FAZ0
ENSDARP00000103132 ENSDARP00000103132 XP_687193.3.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]