SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103365 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103365
Domain Number 1 Region: 295-471
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.06e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0088
Further Details:      
 
Domain Number 2 Region: 446-566
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103365   Gene: ENSDARG00000078604   Transcript: ENSDART00000114217
Sequence length 849
Comment pep:known chromosome:Zv9:3:32931781:32948336:1 gene:ENSDARG00000078604 transcript:ENSDART00000114217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEITTITPSPPGMGEQPVPAPSSPQPLPSETPIPKSSLYGDRAVMGNPTLQTGGRNSSS
WESTPGQNSTSSSSVGTKSTAGPPAEVLAATQGETNGKDDLVEQHAESQSSEQEQQMPPS
PELNPSPNLYPNVQVSQTSSPAPPIDIPPQSTPPPLPNSNPALSSQDSRQTEAQAVPEPE
PNTPSTTMMTHELPCTPSRAEPPAVLVHESAGSLGLPSTYRRPAPDTLSYLESASLMSGT
LESLSGLGEDGSSIGSDSEINGPVRKTDKYGFLGGAQYSETNEAELAVAVARQREMKWLD
MFRNWDKWVSRRFQKVKMRCRKGIPSSLRAKAWQLLSNSQELLDSNPGKFEELEQEQGDP
KWLDIIEKDLHRQFPFHEMFAARGGHGQQDLYRILKAYTVYRPDEGYCQAQAPVAAVLLM
HMPAEQAFWCLVQICEKFLPGYYSAGLEAIQLDGEIFFSLLRRVCPMAYRHLKKFKIDPI
LYMTEWFMCIFSRTLPWSCVLRVWDMFFCEGVKIVFRVGLVLLKQMLGSVDKLRELQGMY
ETMDRLRNIPPESIKEDVLVQEVISLSVTEALIERECSIQVRKWRESRGELTHQPVRRLH
GTRAIYEQKQRAAAISSGGSLSFLGAHVPPPGPLRASSSLLSLPGLRKSKTPFHSQNKKG
SISGSLGQDIVPLQPLGGGTSAVASKPPMPHATNTGASVRPPAPHGPSPLATTSSTTTPP
APTAHASTANMLQPSPKVVSEHITPTIPSPTANNAPLPPCPEITKTAVEEDGKKKKKTKE
DKKREKEEEKQKSREKKEKEKNEKERLKKEKEKAEKEKKKEKGSKKKDKSGAGGETEEKN
GAAAAKDLA
Download sequence
Identical sequences E7F8P9
ENSDARP00000103365 ENSDARP00000103365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]