SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103425 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103425
Domain Number 1 Region: 161-402
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-69
Family Nuclear receptor ligand-binding domain 0.00000000156
Further Details:      
 
Domain Number 2 Region: 49-137
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-27
Family Nuclear receptor 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103425   Gene: ENSDARG00000000151   Transcript: ENSDART00000112817
Sequence length 466
Comment pep:known chromosome:Zv9:3:34773236:34803134:-1 gene:ENSDARG00000000151 transcript:ENSDART00000112817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHILQPHYVNRWPNGVKRKRKNSQCSMNSTSDKSISVPGYVPSYLEKDEPCVVCGDKATG
YHYRCITCEGCKGFFRRTIQKNLHPSYSCKYDSCCIIDKITRNQCQLCRFRKCISVGMAM
DLVLDDSKRVAKRRLIEENREKRKKEEIVKTLHNRPEPTVSEWELIRMVTEAHRHTNAQG
PHWKQKRKFLPEDIGQSPAPTSDNDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELP
CEDQIILLKGCCMEIMSLRAAVRYDPESETLTLSGEMAVSREQLKNGGLGVVSDAIFDLG
KSLSQFNLDDSEVALLQAVLLMSSDRSGLTCVEKIEKCQEMYLLAFEHYINHRKHNISHF
WPKLLMKVTNLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEIQSSPKLFIPHCLS
LSWQSWRRNPSLGPISRFSLTVATAARTSMLCCNIRFVYTNYANKW
Download sequence
Identical sequences ENSDARP00000103425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]