SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104095 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104095
Domain Number 1 Region: 1536-1675
Classification Level Classification E-value
Superfamily PH domain-like 9.7e-48
Family Phosphotyrosine-binding domain (PTB) 0.00000174
Further Details:      
 
Domain Number 2 Region: 298-423
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.48e-39
Family PLC-like (P variant) 0.0017
Further Details:      
 
Domain Number 3 Region: 129-295
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.11e-32
Family Dual specificity phosphatase-like 0.00012
Further Details:      
 
Domain Number 4 Region: 1380-1513
Classification Level Classification E-value
Superfamily SH2 domain 1.27e-20
Family SH2 domain 0.003
Further Details:      
 
Domain Number 5 Region: 31-90
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104095   Gene: ENSDARG00000078842   Transcript: ENSDART00000115118
Sequence length 1678
Comment pep:novel chromosome:Zv9:6:22450413:22558979:-1 gene:ENSDARG00000078842 transcript:ENSDART00000115118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLNWCLAAVISWGKFLFSCFFPLRAARRDKPEDFEAVHSHTFKAKSFKKAKSCAVCKQ
ALTKEGLVCKVCKLSCHKKCEVKVATACESNPTTNPNQNQQASTKSPNMDLKRRPSRRLS
LMQTLEENNEVDLLYITERIIALSFPGGTEENKYSVHLREVTSMLRSKHQQHYLMLNLSE
RRHDITKQNPRVLDFGWPDHHAPALDKICSICKAMDTWLNADPHNVVVLHNKGNWGRTGV
VVGAYMHYSNISASADQALDRFAMKRFYEDKAMPVGQPSQRRYVQYFAGLLSGHIKINNK
PLFLHHVIMHGIPNFESIGGCRPFLKIYQAMQPVYTSGIYNVKGDSHTSICITIEPGLLL
KGDILLKCYHKRYQNPSRDVIFRVQFHTCALHNLALVFTKNDLDDTFKDERFPEYGKVEF
IFSFDPEKIKGLDHLQNGPSVSVDYNTQDPLIRWDSYENFNRRCEDVNVDAAHTQGPIDG
NLYARVQKKNSLEGIVPANGAYSTDRVPPVAEHALPLPVANHQLPAADHALSVSSDSGNS
TASVKTDRTDDAQQSLSSSGPVSQAPPGTVISPCENRELEQLLSGSEGPPHQSFLSFANT
SPGVGVRHLVPAQVHVNGQAGAERETGIIDDELPESQVGDNSAGSLGTLSSFEGQDTPAD
SKTVTECTVVEVEGHCGTFLERRSKKEMPVHQLRGSSSAHGLIDYSGQNEGMYRSQSYGG
MMLDGGHRYLPQAPERNTSSREAVQRGLSAWHQYGLVDDPFFGSNGALPRFSTRGGGSQQ
DVEQSIDALNMLMLDLEPSHTPVPKSQSAPPGENISAFHPPFGQTIARPSYQADQAIYSV
TGGPPLSSSASFGQSSQRSSPAYPITPTSDHQRGYPQTPQTPQTPYSPIYQQDPYSIRGG
SVTTPSPTLTLPSPIKPQYVYPGSEVSYSPDLQGTFPGPQKSYSASSSPLPPVTLAKEPE
PKSEEEMLNLEGLVAHRVAEYNARIRGISKSMSFQSEHHRSYSFSGSHSRTVTPDEAMPT
VRRRTTSESQYLSSQHDSAAHVVRSPLKPVSSEFANTITMNPGGQPKEKSVHSYREAFEE
MESAPFSSAHDNAGLSGQATLSAAGLRAQNPAEALVQQNSSEPHGFVGTGIREGGFISPL
HHPYSPASERPVPPAHTFSPPQPVNNTSSDGFGNQRAFPSFPSEPIRAPLFLDTFSYLNP
DEATVNIMGIHHVPGSPNTLHRTVATNTPPSPALQRRLGGPSSPAFGRRITTANSGSEPT
TPNSPLLGRSGKFIPPSPVLDRHPSPAPVASSPDHKVLPRGQATPDERHGAQSRQSITST
VQPGHATPTFPIEQSSSPSLFLPLDIRAGSSMENSESGPADCGPTQVPPQGPAITSIYDG
PPDIRINIKFVQDTSKYWYKPEITREQAICILKDREPGAFVIRDSNSFRGAYGLAMKVAS
PPPTVQQNKKVGDITNELVRHFLIETSAKGVRLKGCPNEPYFGCLSALVYQHAITPLALP
CKLMIPTRDPNEEALELATPTSSTMDLLKQGAGPPKPTEDFYACNVLYINSVDMESLTGP
QAVAKAITETLAAKSTPTATIVQFKVSTQGITLTDNQRKVFFRRHYPINLITYCNMDPQE
RKWNKAEGGVAKLFGFVARKQGSTTDNVSHLFAELEPDNSASAIVSFVSKLMLNIQKP
Download sequence
Identical sequences E7F355
ENSDARP00000104095 ENSDARP00000104095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]