SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104250 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104250
Domain Number 1 Region: 204-346
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-34
Family Third domain of FERM 0.0045
Further Details:      
 
Domain Number 2 Region: 99-206
Classification Level Classification E-value
Superfamily Second domain of FERM 9.03e-29
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 18-99
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-28
Family First domain of FERM 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104250   Gene: ENSDARG00000079622   Transcript: ENSDART00000110409
Sequence length 572
Comment pep:known chromosome:Zv9:7:31476001:31511273:-1 gene:ENSDARG00000079622 transcript:ENSDART00000110409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLMSGSDRSLDREFNCTVRLLDDSEYTCTVQRDAKGHWLFEQVCQHLNLLEKDYFGI
RFVDPDKQRHWLEFSKPITKQMRSQPPYTMCLRVKFYPPDPAALKEEITRYLLFLQIKRD
LYHGRLLCKSSDAATLAAFILQVAEIGDYDPGKHPEGYSSKFQFFPKHSERLERRIAEIH
KSELTGQSPETSELNFLRKAQTLETYGVDPHPCKDVSGNTAFLAFTPFGFVVLQGNRRIH
FLKWNEVTKLKFEAKTFHIYATHQEDQKIILTYFAPTPEACKHLWKCGVENQAFYQFEKS
SQVRTVSSSNLFFKGSRFRYSGKVAKEVMEQSAKIRREPPEIHRAGMVPSRSCPSITHGP
RQSSVPRTRRRAVHISIMEGLESLRDSGHSTPVRSVSNSNSFLRSQGNGAEGGSGTAEFS
EDSYSPSDSVLPTPVSNDPSDPAQVRHTNGPRNIQEEGGTEQCSQNQARPQGVKPKGKRS
HLEKSRPTQHSPEEGVNQFICSLARLFLVTVALLFALLLLLIVLTESELDLAFLRDIRRT
PEFQQFHYEYFCPLRRWLACKLRWMGGHLINK
Download sequence
Identical sequences ENSDARP00000104250 ENSDARP00000104250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]