SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104454 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104454
Domain Number 1 Region: 218-489
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-83
Family Nuclear receptor ligand-binding domain 0.00000000133
Further Details:      
 
Domain Number 2 Region: 165-247
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-31
Family Nuclear receptor 0.00000928
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104454   Gene: ENSDARG00000057737   Transcript: ENSDART00000124173
Sequence length 495
Comment pep:known chromosome:Zv9:21:16279939:16459148:1 gene:ENSDARG00000057737 transcript:ENSDART00000124173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKPFLSLGFLKPQCSLPPPPQRGRAEACTCFSGMCALHQRRLSTDCTGQVTSSPLSSP
TSHRGMHPSLLSPTSLGPSGSLHSPISTLSSPMNGLGSPFSVISSPMGPHSMASPGVGYG
PSISPQLNSPMNSVSSSEDIKPPLGLNGVMKVPAQPSGTPLSLTKHICAICGDRSSGKHY
GVYSCEGCKGFFKRTVRKDLTYTCRDNKDCVIDKRQRNRCQYCRYQKCLAMGMKREAVQE
ERQRAKERSENEVESTSSANEDMPVEKILEAELAVEPKTETYIETNVPMPSNSPNDPVTN
ICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLA
TGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPG
EVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPI
DTFLMEMLEAPHQMT
Download sequence
Identical sequences F1R1Y8
ENSDARP00000104454 XP_005161241.1.45394 ENSDARP00000104454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]