SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104507 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104507
Domain Number 1 Region: 64-278
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0063
Further Details:      
 
Domain Number 2 Region: 254-364
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.54e-20
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104507   Gene: ENSDARG00000086840   Transcript: ENSDART00000125836
Sequence length 617
Comment pep:known chromosome:Zv9:25:16825258:16909072:-1 gene:ENSDARG00000086840 transcript:ENSDART00000125836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLRRVSSSSSGKSCNKPRRRSSSVGFDEFGFAFSKKRDKKLQQRCHDYSYPQPNPVKVK
ELCEFLSYWNGSSFICRSQIERFIRIGIPPAIRGRVWRCLLNIDSLRATSCFNYEDCQSE
IRRPLVDLGVSEYSIISSIDSLVDTENEISSGQASSPQVADLTLFKQIALDLQRSFPTHR
TLMGDRPEAIEGQAKLFRVLSAFARYNPLIGYVQGMSYIAAVLLMILSEEEAFWALVALL
EKPKYLSELFDSSMKKIQHQALVFHQLLKHRKPLLFQHLETLGVSCVHFIMQWFLTLFTS
LPCWDSVLAIWDLIMLHGLQAVFRTGLTIILLLESRIMNMTEEATVLPLLLRVPIDICHH
RVLIPALWSTDLQEWEINCMNSLVLEELDSTQDEEKANKENTKISTASFSDGQLHDEKPL
QETAKKEASASSSKSVFTRLLKVAQHFILKSGKYSSAAKSSPTKRSPAPGRLAKTRTSSH
FTQTQVRGRRSSSRRSQSSSQGGVRKEKLPSQNSDGGAAEDSSDSSAWRVRSGPVGKVAR
RRSRDQSRRGSSFHSRSRRSRSQQTPAIKTVQPESNKTDDCKETPNRPASRPRLSLKERN
FITCPTTASQVRESQLI
Download sequence
Identical sequences E7EZ23
XP_687788.5.45394 ENSDARP00000104507 ENSDARP00000104507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]