SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104593 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104593
Domain Number 1 Region: 726-972
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.78e-63
Family Nuclear receptor ligand-binding domain 0.0000000596
Further Details:      
 
Domain Number 2 Region: 602-679
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.42e-26
Family Nuclear receptor 0.0000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104593   Gene: ENSDARG00000037025   Transcript: ENSDART00000125011
Sequence length 974
Comment pep:known chromosome:Zv9:1:36644018:36792890:-1 gene:ENSDARG00000037025 transcript:ENSDART00000125011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKRYQSCCEGAKAENKWAQMPNTADYICSAEESLTNSDVLMDIVNSSNTPNVQSICKD
NNFKNTEATMIRVNQNQPLPFPTFNNCFNNRKSETDSKELSKTVAESMGLYMNAAREADF
GFSQQGAAGGQGSPGKLYPLCGRTNEDSQAKTSGSPKMKAPPASFPPGAQLPNGGPQECA
VVSDSVPSALVTALSSSTDGSCPMSSPTGHNMVSSTTSPTYFDSDCPTLDSATSSLTHCQ
HTSPNICSPVKSSIVGSPPLPSPLSVMKSPVSSPHSIGSVRSPLSCNTNMRSSVSSPTTN
GGNTCNIKPSISSPPTAGSMSMSSPRNSSRGFSVSSPPSGLGLVQNDVNSPESREHDFKG
FEFPKVENVDGEIFNIGLDAMGVAKYIKNEPGTDFRSMCLGSSKSAMSNSPFVTHIKTEP
NREVTCSNLQFAEPQHSLGCFPSTETTYLSLRDNIDEYSLSGILGPPVSSLNGNYEPGVF
PNNGLPKGIKQETNDGSYYQENNNVPTSAIVGVNSGGHSFHYQIGAQGTMSFSRHNLRDQ
TNPLLNLISPVTGLMETWKTRPGLSQGPLTARGDGYPGAVCLTENMERNTLRGASTASSH
PAKVCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPAC
RVRKCLQAGMNLGARKSKKLGKIKSISEDSSLQSSKDGPFLTSEKELSSSTALVPHTPTV
APYLTPSVCSVLELIEPEVVFAGYDNTQPDTTDHLLTSLNQLAGKQMIRVVKWAKVLPGF
RSLPIEDQITLIQYSWMCLSSFSLSWRSYKHTNAQMLYFAPDLVFNEERMQQSAMYDLCV
GMRQVSQEFVRLQLTYEEYLAMKVLLLLSTVPKDGLKNQGAFEEMRVNYIKELRRSVGKA
TNNSGQTWQRFFQLTKLLDATHDLVRSLLDFCFYTFRESQALKVEFPEMLVEIISDQIPK
VESGQTHTLYFHKK
Download sequence
Identical sequences ENSDARP00000104593 ENSDARP00000104593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]