SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104916 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104916
Domain Number 1 Region: 18-168
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.51e-21
Family Synaptotagmin-like (S variant) 0.062
Further Details:      
 
Domain Number 2 Region: 1239-1266
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.00000000301
Family Eferin C-derminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104916   Gene: ENSDARG00000088248   Transcript: ENSDART00000122870
Sequence length 1271
Comment pep:known chromosome:Zv9:14:48198488:48238780:1 gene:ENSDARG00000088248 transcript:ENSDART00000122870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLISLDDEEQRWVPTHVNVTVLRARALRTKGKQGSRYVYTIIQVGKEKYTTGLVEKAEE
PQWGEECAFELLPGLLEAGGTSAYPPGSSNLVFTVMHRVLIGLDVFLGQTIVPLDKVFQE
GTCPRNEWLKLHSKAGRKEKERGELQVTIQFTRNNMTASMYDLTVKDKPRSAFGKLKDRV
TGKKRDVESSSAVLPGRYAALSGSVGPPFAGDGGSYEASEEDGVEEHRSKVKDFFLKGKL
RKNSDTRSCSSLASDSSMASSAGDPFIPVEIPRTPIYSSRVMEPFRMDTEEAIKVMTHKR
AHSDEASKITCVPRPSPAVENLSQSTLCINGSHIYSSEPVSPKSPSAIPAKRSLLEKCAP
LSRSLQNLTRRGEDSQKSDGRRWSIDKSKKEDLETNAAQSQTQGSTIVDGKPVQAAGAVD
VLDKGKKLRKTLFSSGRSDSLPAKPEQGQVSAPVEGRRRGWFGSGDSQNKPRLGVSPKVE
SSSELPCQIPCSPSQPPCSLPLGCTTGSVSPPSGNPFTPSSPTPPSISPSNPFLTRLQQN
PFFEELIAEEALKSPTAGYCSLNSSLYHPVSRSSVLRNGAQNRIPTIKRERPRSMSRQRS
LPTIMPETPDTNSNGNPNHCLSERVGDWDDFEAFASSRLKSPSGTPTRPPSAPFPNTNLM
ECVNDTTIGLRVDEVDMGVSRQWDLPPLPPRRPIRTQVVSTDSWLDRAQEMAVQKEACFL
SQTDFASLQHVRDGDVKRNSQTVCSDKVLHNFSSVENNNMELQSGIKLSEYIGEPTGQDF
ATNNNANTSPNGFVEDALGSSECEYTVPETLCFPSDWETTVAESLCSSPQTQPKQDSELS
FEGKVSDEQQCKSKTNDVNLLTLSPRDSNNNTDVTSEFAFIDSESSPSELQPFEIKNGSK
ECSNVHFGSGSSLPRCSPGIPEDILSKMASELDMFSPKNALCSSPYERSCEGLGEQKANS
CENQNCDVDVLLNNDNTVTNPKMSESDCILHTTHNNEEHKVLDSENKLEPEVSLSTDNKI
QEYTSTSEQQISFEDLHARVAPRNSRSPCKMEVRSARIRPRSTTSSPKNVQGADQLPDSH
TPTSNLSLHDPTPSPSQLLDTNSCLHSDPSLPANPQNERPSMGSTRSTTIQPHEESSPHP
VKPLTNNTLQGEKKAESRSVLEKLKSTINPGRSALATTAEEEKQQLSLMEARAHYQNMTN
MELIALLLQQELEIKKQRAETEVQVVMLEKRDAELKKMKVQVRDLEDYIDKLLVRIMEQT
PTLLQVRGRLK
Download sequence
Identical sequences XP_017214657.1.45394 ENSDARP00000104916 ENSDARP00000104916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]