SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105666 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105666
Domain Number 1 Region: 140-403
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.47e-79
Family Nuclear receptor ligand-binding domain 0.00000000169
Further Details:      
 
Domain Number 2 Region: 39-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-27
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105666   Gene: ENSDARG00000091024   Transcript: ENSDART00000130091
Sequence length 404
Comment pep:known chromosome:Zv9:25:2294626:2323225:-1 gene:ENSDARG00000091024 transcript:ENSDART00000130091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVFVSLFCVADALTPASSPSSGVYGCPVGQDEFTSTSLNLECRVCSDRASGYHYGVHACE
GCKGFFRRTIRLKLEYDKCERRCKIQKKNRNKCQYCRFQKCLSVGMSHNAIRFGRMPQSE
KLRLKAEILTGERDVEDDQKTLAKQIYEAYVKNFNMNKSKARTILTGKTSTPPFVIHDME
TLQLAEQTFVAKMMGSCGGLLNKDPEVRIFHCCQCTSVETVTELTEFAKSVPGFSNLDLN
DQVTLLKYGVHEALFAMLASCMNKDGLLVAYGSGFITREFLKSLRRPFSDMMEPKFQFAM
KFNSLELDDSDLALFVAAIICCGDRPGLVNVPHIERMQESIVNVLHLHLKSNHPDHGFLF
PKLLQKLVDLRQLVTEHAQLIQEIKKTEDTSLHPLLQEIYRDMY
Download sequence
Identical sequences ENSDARP00000105666 ENSDARP00000105666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]