SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105933 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105933
Domain Number 1 Region: 76-122
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000419
Family Elafin-like 0.001
Further Details:      
 
Domain Number 2 Region: 123-167
Classification Level Classification E-value
Superfamily Elafin-like 0.000000209
Family Elafin-like 0.0032
Further Details:      
 
Domain Number 3 Region: 39-76
Classification Level Classification E-value
Superfamily Elafin-like 0.000000968
Family Elafin-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105933   Gene: ENSDARG00000089187   Transcript: ENSDART00000124091
Sequence length 168
Comment pep:putative chromosome:Zv9:23:12524841:12530006:-1 gene:ENSDARG00000089187 transcript:ENSDART00000124091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTARLSCSLSALFFLCLSGCWSSLLAAPRLNDTVVLHCPGKLTVMPSSRGCASDRDCSG
GHKCCVFDCGAVCVPPAFTKPGVCPHRRFGAGMCAEYCVNDSNCPSNEKCCSNGCGHECT
PPYTVKPGRCALPRGTPMCAEYCYHDGQCPAKQKCCPTTCGHACDDPC
Download sequence
Identical sequences E7F3G3
ENSDARP00000105933 XP_684531.2.45394 ENSDARP00000105933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]