SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000106136 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000106136
Domain Number 1 Region: 13-125
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-31
Family Nuclear receptor ligand-binding domain 0.0000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000106136   Gene: ENSDARG00000087092   Transcript: ENSDART00000127008
Sequence length 139
Comment pep:known chromosome:Zv9:7:70180501:70183923:-1 gene:ENSDARG00000087092 transcript:ENSDART00000127008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNDFIIPVGGSEQEMSKVAVRILEELVRPLKELNITDTEFVCLKTIVFFAPDCPGLQCAQ
AVRRLRFQAQVLLDEATSEQRGRFGELLLLLTTLQSVAWQMLEQLQLMRLLGRASVDSLL
MEMLLGEEATRGSESLPAT
Download sequence
Identical sequences F1QBR4
ENSDARP00000106136 ENSDARP00000106136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]