SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000106236 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000106236
Domain Number 1 Region: 256-505
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-70
Family Nuclear receptor ligand-binding domain 0.000000000855
Further Details:      
 
Domain Number 2 Region: 63-148
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-31
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000106236   Gene: ENSDARG00000031768   Transcript: ENSDART00000121449
Sequence length 516
Comment pep:known chromosome:Zv9:25:34896334:35011591:1 gene:ENSDARG00000031768 transcript:ENSDART00000121449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESHGFWCGHASAAERQSYAGQLLLKRQWTCTALALAAPSAYGPPSLMMYFVISAMKAQ
IEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNAAYSCPRQKNCLIDRTSRNRCQH
CRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRLQQQQRDHQQQPGEAEPLTPTYG
LSTNGLTELHDDLSGYMNGHTPDGTKPDSGVSSFYLDIQPSPDQSGLDINGIKPEPICDF
TPGSGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHMETCQYLREELQQMTWQAFLQEE
VENYQSKPREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFVR
MCRAFDPQNNTVYFDGKYAGPDVFKSLGCDDLISSVFEFGKNLCSMHLSEDEIALFSAFV
LMSADRSWLQEKVKVEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCSRHTEK
LTAFKAIYPDIVRAHFPPLYKELFGSDFEQSMPVDG
Download sequence
Identical sequences ENSDARP00000106236 ENSDARP00000106236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]