SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000106954 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000106954
Domain Number 1 Region: 171-429
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.22e-59
Family Nuclear receptor ligand-binding domain 0.000000313
Further Details:      
 
Domain Number 2 Region: 97-175
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-26
Family Nuclear receptor 0.000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000106954   Gene: ENSDARG00000015064   Transcript: ENSDART00000125432
Sequence length 431
Comment pep:known chromosome:Zv9:18:47829949:47841324:-1 gene:ENSDARG00000015064 transcript:ENSDART00000125432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASTSDDPPSPTDTPLKADPLSPSFSLESSATPFSPGSTSDSSGYSVFSRNPSLNPDSPVS
SSSISSSSAPVLFHPAGHPEHALISDYIPSLNPGPKRLCLVCGDFASGYHYGVASCEACK
AFFKRTIQAGNIEYSCPVVNDCEITKRRRKSCQACRFQKCLRAGMMREAGVRMDRVRGGR
QKYKRRVDSTLSVFSKTAYTHANKPIRNRLICELLLCEVTPLRAAPDSSTPDSDLKTLMT
LCDLLNRELLVMIGWAKHIPGFCALSLLDQMALLQSGWMETLLLNVAWRSQALAEELQFA
ENLRLNESQSQAAGLHDLYTALRHLTCRYQQMSLKQEEFIILKAMALANSDAENVEGAEA
VQCFQDALHEALQEFEISQHPSEAHRAGRMLMTLPLLRQTANRSVRCFRRLHTDGHVPMH
KLFLEMLEAKS
Download sequence
Identical sequences ENSDARP00000106954 ENSDARP00000106954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]