SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107072 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107072
Domain Number 1 Region: 374-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-48
Family SPRY domain 0.00066
Further Details:      
 
Domain Number 2 Region: 10-81
Classification Level Classification E-value
Superfamily RING/U-box 4.42e-20
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000275
Family B-box zinc-binding domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107072   Gene: ENSDARG00000087057   Transcript: ENSDART00000124702
Sequence length 546
Comment pep:known chromosome:Zv9:2:60104663:60111000:-1 gene:ENSDARG00000087057 transcript:ENSDART00000124702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSLSLAHHFSCSVCLDLLKDPVSIPCGHSYCMSCITDCWNQEDQKRVYSCPQCRQTF
SPRPALAKNTMLAEVLEKLQKSKLQAAGPAQSPAASGDVECDVCTGAKNRAVKSCLVCLN
SYCHTHFQRHQEIHPGNQHKVTEATHKLQEMICPQHEKPLEIFCRTDHCCICYLCMVDQH
KHHDTVSAAAERTEQESRLRETQSRFQQRLQERQKELEELREAVESHKRSAQAAVDHTER
IFTQLICWIERSRSELTQMIRDGEKTAVSGAEERLERLEQEINDLRRRNAELEQLSHTED
HIHFLQSLQSLSVPPGSTDSSSFFISSQLSFDQLAESVSRLRDKLQQFCTEEMKTISSRV
SSISIIPAPEAQTHEQFLQYSQQFTLDPNTAHNRLVLSEGNTAVENNWSVQPYPDHPDRF
DGYSQVLCRESVCGRSYWELEWSGNGVEISVSYKSISRKGSGNECLFGRNDQSWSLCCSP
LSLSFYHNNINTKLPKPSVSSSRIGVYVDHSAGTLSFYSVSDTTMSLYPGFYVNYSSRLK
LCDLTV
Download sequence
Identical sequences ENSDARP00000107072 ENSDARP00000107072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]