SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107363 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107363
Domain Number 1 Region: 190-421
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-60
Family Voltage-gated potassium channels 0.00086
Further Details:      
 
Domain Number 2 Region: 34-143
Classification Level Classification E-value
Superfamily POZ domain 7.33e-32
Family Tetramerization domain of potassium channels 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107363   Gene: ENSDARG00000038862   Transcript: ENSDART00000129365
Sequence length 824
Comment pep:novel chromosome:Zv9:2:29859811:29892301:1 gene:ENSDARG00000038862 transcript:ENSDART00000129365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERANFGAQRVSRPQGSLPPEPIDIIRTKARSRRVRINVGGLVHEVLWRTLDRLPRTRL
GKLRDCNTHETLMEICDDYSLNDNEYFFDRHPGAFSSILNFYRTGKLHMMEEMCALSFGQ
ELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETLREKEGDQVDTGCCPDKRQKLWD
LLEKPSSSVAAKVLAIISILFIILSTIALSLNTLPELQVIDEFGQSNDNPNLAHVEAVCI
AWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQ
IFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDED
ATKFTSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFS
EFYKEQKRQEKAIKRREALERAKRNGSIVSMNLKDAFARNMELLDVVIEKNEDKAADNHL
SPSRWNYQKNPNSELGSKGFDSKYQEVGQLASPERVFRSTPSPQRLNAKSLEQMYNQMTA
ASSMSSSGPSASKVSTVVGREEEMEMKVVQCEPRLKEKPVTEIRSLSSVDSFASCATDIS
EVERSALLPNFAGRHPRAPPPLDLSQITSLEKRAKQPTIIKEGLYEFVPCKSDGSSTMSQ
GEENQSFDQSDENVRSPPQGNQVKLKGLKVNFTESAEEGASNLHLVVTDDVATLTPKVPV
SDPLLLAGSPRQSPRATEGDGATSSPGFSLSSSESQRGRNHVDRAAVTPTSPKSAQNCAS
ATAGAVGAEDNIQSGQKVDNHLLSPDILKSSGDGGRSPPCETSM
Download sequence
Identical sequences B0V2U3
ENSDARP00000107363 XP_005163503.1.45394 XP_683673.2.45394 ENSDARP00000107363 7955.ENSDARP00000056740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]