SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107405 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107405
Domain Number 1 Region: 1090-1107,1144-1252
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000039
Family Synaptotagmin-like (S variant) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107405   Gene: ENSDARG00000090971   Transcript: ENSDART00000126768
Sequence length 1666
Comment pep:known chromosome:Zv9:23:2209630:2273572:1 gene:ENSDARG00000090971 transcript:ENSDART00000126768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPGDVREKIKKKRRELQESLGKVRDDKQALVPSDWDVSKENEHTAVEEMAGGKEDPGE
TLRHSLMARRMKKKKKLLKESAVECIADDEELTAVQDTRGADGQHARTPTELSPRDASPH
TVMRPGSSQSEKTMRQRMTEKLRAAKSKAASLLEQESSIEPVSRLQSLQDRNTVTRFDRD
MDPDLRADEDSSFAARLKFRDAARRAVKDKQVEAGLPTAEEAYNFFTFNFDPEPEQQRQK
KKRRSRRREAEEEEEGDSEGEVEGEDEEGEEVGELERQNEGEEESEARDEDDPLVGDEED
LFIIDQSAQDFLEVRRAEYVDYSRRLQRERDTLFVPSMRPVPASSKLAENTRPRFLEEEG
LYVGERPHVCLTNLNILENRILKQAEGRKWFGDDGRIVALPDPIKESSSRPPLFHLEDQL
DPALQTVYRKALKSKHVNLYIAGMGDHQADYQLDVDVSGLIFSHHPLFSREHVLGARLAQ
LYDQHLTRLHKNLTQLLTDKLNSLRNTIHNMLELHRGEALSQVSQQRIAEYKQEVRHTRQ
LRDVEQEKDRALLKNIIRLWKELKALRDFQRFTNTPYKLFIRREKVERLQDEQEFESDIM
AEVSELQAETEEEYQRKMNEYRRLHEEWKSWKRKQKALKKKQKKKRQEEEEEDEVSEEEL
GEEPEKPNPPEKPDTSILEEQVREKAARIRRNPGEPVLIPELTVSGSITANEQCPRAEFA
RREDVAKRSLFVKVLYNDKEVSRTDSRTLNMDFRVHFGQIFNLKIVNWPESIKLQVFESV
GSSSTQLTEVCVPVPESSVLTGSAPSEEMEFSSNQRVTFNHEGVGSGVPFSFEADGTNPQ
TLLTSGKLSCCVSWAVGEDDVPLAPPSAQPGVAMHSGLRQMDAIACIGASGLNDMKKLGK
WAAESRLDPNDPSNASIMQLLSVVSGGDMGVPEYFRLEQLQEEFNFLSEEELQRSRRYRL
LRLRSQEVQEFRHFKCVPSTDREISEKVFQDYENRLKEGEIIDTKEHIDAHRALVAKYLQ
RVRESVINRFLIAKHHFILSDVISEDEVPSIGVLGWNLFKLAEPKRPLKPRRKERKKVTA
QNLSEGDIKLLVNIIRGYDIPVRRPYTGKAPVSAKSGRSFTETFTAPASQTGQQGSEWPF
AQPLIRPFVEVSFQRSVLQTSTAEGPNPCWNEEIVLPFSAPNGDYSSTSLQSVRDEVFIN
VFDELLYDVVEDERERGNTIHTRIERHWLGSINIPFSTIYLQSRIDGTFKVCTPPVLLGY
SKERSLGSEGGYDAVRSPSEGTFLSLFITIEPQLVPGDTVREKFDSQEVERVLLASEVFE
KEASRRFSDRPCITTVIDINGKTVFVTRFIRPLNPPQELLDASPNGTQDSTELVARYVSL
IPSLPDSVSFAGVCDLWSTCDQFLTLLAGDEEEHAVLLCNYFLSMGKRAWLIIGSAIPEG
PTAYVLTYEQSRYVIWNASTGQHYGQYDVFCPLQTIGCLINADNVWFNIQPYAAPVRMSF
DISKPNLWKPFFSRAFPDPGLSSVQPDALVYRRTDRTAAVELQDRIEKVLREKLMEWRPR
HPTRWNRYCISTLRQFLPKLELSGGREVAEEHRLELQSLLGEYRISGFPLHLPFSELRPI
IEAVHSTGVHKVESPNVEFALAVYVHPYPSNVLSVWVYIASLVSAY
Download sequence
Identical sequences E7F3T4
XP_003201209.2.45394 ENSDARP00000107405 ENSDARP00000107405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]