SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107707 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107707
Domain Number 1 Region: 540-680
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.7e-32
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 
Domain Number 2 Region: 1357-1488
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.23e-22
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 
Domain Number 3 Region: 404-465
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000778
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 
Domain Number 4 Region: 1-95
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000359
Family PLC-like (P variant) 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107707   Gene: ENSDARG00000086274   Transcript: ENSDART00000126832
Sequence length 1534
Comment pep:known chromosome:Zv9:10:17128336:17237271:-1 gene:ENSDARG00000086274 transcript:ENSDART00000126832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEISRLDLGLIVEVWNKGLIWDTMLGTAWIPLKNICHSDEEGAGEWIFLDSEVLMKADE
IYGTKNPTPHRVLLDTRFELPFEIPEDEARYWTGKLERINAMGIHDEFPLQDEVVGRPLP
CAASQCSLDDLDSAVEDRDSDYRSETSSSLPPRYHTTAQPNSSLHQYPMGPRFQQHMDSC
ADSLHSFEFDYRDHRASSPVNSSRFGSSGNLSQASSQLSETGQESAACSELEESYHSYHS
TGYRPSRNGHHPTNGHASWGEDEGLKSSQENGKDTSSTLKKEVVSQVDKMPEKSPKSFKD
DGLPLPFSPSRVRWLKAINKVRVQLKEGKENGDNSRHAWVKAGNGSGIFGIDSMPDLRKK
KAIPLVSDVSLVQARKAGIASAMASRSSIKDEELKNHVYKKTLQALIYPISCTTPHNFEV
WTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQELLNADCLQRAAEKSSKHGAED
RTQNIIMAMKDRMKIRERNKPEIFEVIRDVFVVSKAIHAQQMKTIKQSVLDGTSKWSAKI
TITVFCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEEKFHFECHNSSDRI
KVRVWDEDDDIKSRVKQRLKRESDDFLGQSIIEVRTLSGEMDVWYNLEKRTDKSAVSGAI
RLQISVEIKGEEKVAPYHVQYTCLHENLFHHITDVLGQGVVKIPEARGDDAWKVYFDDVP
QEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTNVS
ASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSKDRLQDLKSTVDLLTSITF
FRMKVQELQSPPRASQVVRDCVKACLNSTYDYIFNNCQELYSRQYPQIGDTHKDDCSPED
QGPSIKNLDFWPKLITLIVSITEEDRNSYTPVLNQFPQELNVGKLSAEVMWSQFSQDMKY
AMEEHEKHRLCKSADYMNLHFKVKWLYNEYVKDLPAFKGIVPEYPTWFQQFVLQWLDENE
DVSMEFMHGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIKKLECPDPKVMALY
SRRFAKTIDKVLLQYSAILKKSFPSYCDKEKIPCVLMNNVQQLRVQLEKMFESMGAKQLD
TEASDLLNDLQVKLNNVLDELSSTFGNTFQSRIDDCMRQMASLLYQIKGPVNTNNKNQVE
ADSDNMLRPLMDFLDANLMLFASVCEKTVLKRVLKELWRIVMNSLEKTIILPQGNDTFGM
IFSAAKELGQLSKLKDHMSGEAKSLTPKQCAVMDVALDTIKQYFHAGGNGLKKAFLEKSP
ELSSLRHALSLYTQTTDTLIKTFVTSQHAQGSGVDKPVGEVSIQIDLFTHPGTGEHKVTV
KVVAANDLKWQTSGMFRPFVEITMIGPHLSDKKRKFTTKSKNNSWAPKFNETFHFILGNE
DGPECYELQVCVKDYCFGRADRVVGIAVIQLRDVAPRASCACWCPLGPRIHMDDTGLTVM
RILSQRSGDEVAKEFVKLKSDTRSAEEEMTQAAK
Download sequence
Identical sequences ENSDARP00000107707 ENSDARP00000107707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]