SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107732 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107732
Domain Number 1 Region: 400-576
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-49
Family SPRY domain 0.000093
Further Details:      
 
Domain Number 2 Region: 8-72
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-17
Family RING finger domain, C3HC4 0.0046
Further Details:      
 
Domain Number 3 Region: 145-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000275
Family B-box zinc-binding domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107732   Gene: ENSDARG00000090028   Transcript: ENSDART00000126266
Sequence length 579
Comment pep:known chromosome:Zv9:19:49825613:49832914:-1 gene:ENSDARG00000090028 transcript:ENSDART00000126266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAELFSEQELTCSICLDLFSEPVSTACGHNFCQGCIGGYWASSAVCSCPLCKREFEERP
ELSINRVFAQIALKYQQMRYGEAAQARQENPSAEAEPKLEPVFCDVCSGVKKPALRSCLT
CTASYCDTHLQPHLHTPFYSTHRLLPPHDALRGRTCREHGRLLEVFCRTDQRCICAICVL
EEHRTHTTVSVQTERALKQRLLGKMELELQVCVDRRSAQLAELKTKLLTVQRYSQAEQAE
VEQLLSDMSSSIQRIRSELVGGIQDKREAVIGRGQRMVSQQESKLAQLQEHRARLEAQAI
SDDHIGFLQSFQAASGPMQDEAGQEAEQEAELTLRFSLGDVKAALGEIRDRLEDIRSGEV
QYRHSVSTLAESESMMSVRSMRRKDWSLKDLRRIKTGHKKVKGYLEDVSLNPVTAYPFLI
LSEDRKQLKRGEKLQFYRNNTQRYDVWSCVLAKESFQTGRHYWEVSVGENRDWKLGVVCE
SAQRKGLFDMTPAAGYYALWWSGNHLRALTAPSLSKVKVAGHLRRVGVYLDCEEGQVIFY
NAKSGAELYCFSGPLSEKMLPLFGTADKEVPMVLCSAAD
Download sequence
Identical sequences ENSDARP00000107732 XP_021323868.1.45394 ENSDARP00000107732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]