SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108609 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108609
Domain Number 1 Region: 690-974
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.32e-42
Family C5 cytosine-specific DNA methylase, DCM 0.0037
Further Details:      
 
Domain Number 2 Region: 352-493
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.2e-35
Family PWWP domain 0.0000172
Further Details:      
 
Domain Number 3 Region: 273-336
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000000254
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000108609
Domain Number - Region: 593-663
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00118
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108609   Gene: ENSDARG00000015566   Transcript: ENSDART00000126823
Sequence length 978
Comment pep:known chromosome:Zv9:17:37108385:37156049:-1 gene:ENSDARG00000015566 transcript:ENSDART00000126823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSNTVATAAAAFKSSDFNCDTNGNQMNESSMETMIIDEMPSLCTPVRKVGRPGRKRKHL
HVTCYGPLNQLMAKQHKEAELQSSLQSQNGEVERHENKSIEGRHSTLDKRDVENGLFCQS
GCKAESTSDSSLSPSLENGFVSSQDSEKCDEETLPTLPRKKRGRRKLERPTKYVEHKEDE
SGDPSKNEGARGRLRGGVGWEVSLRQRPMPRVTFQAGDPYYISRRTREELLAKWKLEAEK
KAKLVSVMNSMEDHGEVESEPKKDVITVPLLFPPPMPPTPPTPPMQQQPPQPQAQHQTNL
KPQPSPQQQPPPFQQQQQQQPTDPASPTVATTPEPVSIGDGDKTSPKSTESEYEDGRGFG
INELVWGKLRGYSWWPGRVVSWRMTRRSPAAEGTRWVTWFGDGKFSVVCVEKLLPLSSFH
NAFHQPTYNKQPMYKKAIFEVLQVASTRAGKTFLSCPASDDTDSSKLVDVENKKMIEWAM
SGFQPTGPKGLDPPESEPYEMCEWVEPEAASYLPPPAKKPRKSTVTEKPKVKEMIDERTR
ERLVFDVRQKCRNIEDICISCGSLYVSLEHPLFIGGMCQSCTNCFLECAYQYDDDGYQSY
CTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGLKTQYGLLE
RRADWPCRLQHFFANNHDQEFEPPRLYPPVLAENRKPIRVLSLFDGIATGLLVLRELGIQ
VERYVASEVCEDSITVGIVRHQGRIMYVGDVRQLTRKNIQEWGPFDLVIGGSPCNDLSIV
NPARKGLYEGTGRLFFEFYRLLHEARPKEGDTRPFFWLFENVVAMGVSDKRDISRFLECN
PVMIDAKEVSAAHRARYFWGNLPGMNRPMSAMCTDKLDLQDCLEHGRTAKFGKVRTITTR
SNSIKQGKDQHFPVFMNDKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVP
VIRHLFAPLKEYFACVGT
Download sequence
Identical sequences F1R1K5
NP_001315096.1.45394 ENSDARP00000108609 ENSDARP00000104553 ENSDARP00000126446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]