SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108778 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108778
Domain Number 1 Region: 201-439
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-72
Family Nuclear receptor ligand-binding domain 0.00000000679
Further Details:      
 
Domain Number 2 Region: 91-177
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-28
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108778   Gene: ENSDARG00000043170   Transcript: ENSDART00000123268
Sequence length 441
Comment pep:known chromosome:Zv9:7:35756118:35776269:-1 gene:ENSDARG00000043170 transcript:ENSDART00000123268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLSATDITDVGHGDSLGCDSEEGPSAAMAEVKQEILSQTDLYNTSHDDLNDSMLMESN
DIKMFFREDKAAPEGQPVKRKKGPAPKMLGNEVCSVCGDKASGFHYNVLSCEGCKGFFRR
SVIKGAQYSCKNSGRCEMDMYMRRKCQQCRLRKCREAGMLEQCVLSEEQIRLKKMKKQEE
ETARTSTVATPSPAPEMPPLAPEQQEMIEKLVAMQKQCNKRSFIDRPKVTPWPQSQDPQN
REVRQQRFAHFTELAIMSVQEIVDFAKQLPGFLELTREDQIALLKTSTIEIMLLETSRRY
NPAIDSITFLKDFTYNKEDFAKAGLQLEFINPIFEFSKGMNDLHLDEAEYALLIAINIFS
ADRPNVQDHELVERLQQPYVDALHSYIRIKRPNDHLMFPRMLMKLVSLRTLSSVHSEQVF
ALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences A0A0R4IVP0
ENSDARP00000108778 ENSDARP00000108778 NP_001017545.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]