SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108869 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108869
Domain Number 1 Region: 229-363
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.29e-21
Family Synaptotagmin-like (S variant) 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000108869
Domain Number - Region: 73-200
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0164
Family Synaptotagmin-like (S variant) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108869   Gene: ENSDARG00000090571   Transcript: ENSDART00000121901
Sequence length 368
Comment pep:known chromosome:Zv9:18:402330:410091:-1 gene:ENSDARG00000090571 transcript:ENSDART00000121901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLPGPQKSRFSLRRLSSPVITCKLGKPAIRGRSSLPTIPKLSLSVKSHSRVDDDSNSE
NSKIKVYNDRHYGSSRSTPSISFTLLYSSSNSRLTVSVLGVFRGSRRLSGMQVTACLPPL
CPETLQAGRKQRRRRSLSAECPAQVFSLQVWSVQELQTCTLRLSISSRDFSGLRETPLGE
LEMSCAEIQWESDHTFSLTRQLNPARRKLRKSQSCQAAVGAPVSLLRSLGQILILLQYQS
LAHRIKVMVRKAQNLPKLSRMPGTPDHSVIINLLQDGTVISTKETKCSSGLNPVWNAPFL
FDLPAGDVSTLMLEFIIMQGRLYAKSCVLGRVLIGCEGSEAGNQHWREMRNTPQVETACW
HLLQQDTP
Download sequence
Identical sequences ENSDARP00000108869 ENSDARP00000108869 XP_021326509.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]