SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109331 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109331
Domain Number 1 Region: 231-495
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.18e-83
Family Nuclear receptor ligand-binding domain 0.00000000153
Further Details:      
 
Domain Number 2 Region: 126-208
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-26
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109331   Gene: ENSDARG00000044525   Transcript: ENSDART00000123458
Sequence length 496
Comment pep:known chromosome:Zv9:22:986748:1002624:1 gene:ENSDARG00000044525 transcript:ENSDART00000123458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVCEMDRRHVLALRSRLPRNLGSVGGVYMDPGDSSPCSSQGEGPDDQRLQDVLCELGEG
AGLNLELESEGGVALQGEELSWETSRQEEQSNTSSTSPDRSSASTDLSTALSEQLLRGRE
EVSGINMECRICGDRASGFHYGVHACEGCKGFFRRTIRMKLEYERCERSCKIQKKSRNKC
QFCRFQKCLMLGMSHDAIRYGRMPEAEKRKLVAGLLAGERGSQNSNESDLKTLAKRVNNA
YLKNLNMTKKKARNILTGKTSASTPFVIHDMDSLVQAENGLVWNQVIHGAPPNKEIGVHV
FYRCQCTTVETVRELTEFSKSIPGFIDLFLNDQVTLLKYGVHEAIFAMLPSLMNKDGLLV
ANGRGFVTREFLRSLRKPFSEIMEPKFEFAVKFNALELDDSDLALFVAAIILCGDRPGLM
NVHQVEKIQDSILQALNQHLQLNHPDGRFIFPRLLQKLADLRQLVTENAQLVQKIKKTES
ETSLHPLLQEIYRDMY
Download sequence
Identical sequences F1QJT0
XP_699900.6.45394 ENSDARP00000109331 ENSDARP00000109331 ENSDARP00000124414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]