SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109842 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109842
Domain Number 1 Region: 200-431
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-60
Family Voltage-gated potassium channels 0.00086
Further Details:      
 
Domain Number 2 Region: 43-152
Classification Level Classification E-value
Superfamily POZ domain 4.19e-31
Family Tetramerization domain of potassium channels 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109842   Gene: ENSDARG00000088842   Transcript: ENSDART00000123450
Sequence length 698
Comment pep:novel chromosome:Zv9:24:13266405:13470148:-1 gene:ENSDARG00000088842 transcript:ENSDART00000123450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPLVSLHAMAEKAGLGVPKPGGRSVSSLPPEPIEIIRTKARSRRVRINVGGLNHEVLWRT
LDRLPRTRLGKLRDCNTHDSLMEVCDDYCLNENEYFFDRHPGAFTSILNFYRTGKLHMME
EMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETLREREGEGEFDNTC
CPEKRKKLWELLEKPSSSVAAKILAIISILFIVLSTVALSLNTLPELQVTDEFGQANDNP
QLAHVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVL
QFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSS
LVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIAL
PIPIIVNNFSEFYKEQKRQEKAIKRREALERAKRNGSIVSMNLKDAFARSMELMDVTVEK
SDDKRLTDNHLSPSRWGIPQRTSSDTSLRSFDKKFPNSGSQEYVHMPSPQHLNAQNLEEM
YNQMTKTQSFSDLSTSNSTQPAVVSKHEVELEMKEVPTAVKQQPKERTITDVRSISSVDS
FASCTAEFGQGEKATTPSHTAEQFQQRLPKVSPQLHLGQLTPSDLSPEENSGIVNRDTDD
LNEFVENIRSSIRGTNPIKAKGLKVNFIETPEDAPLTP
Download sequence
Identical sequences F1QCW6
ENSDARP00000109842 ENSDARP00000109842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]