SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110137 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110137
Domain Number 1 Region: 253-516
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.78e-82
Family Nuclear receptor ligand-binding domain 0.00000000139
Further Details:      
 
Domain Number 2 Region: 149-232
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-26
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110137   Gene: ENSDARG00000009473   Transcript: ENSDART00000128783
Sequence length 517
Comment pep:known chromosome:Zv9:8:24564839:24577984:1 gene:ENSDARG00000009473 transcript:ENSDART00000128783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQVEEPTSEMKCDGQVDGVMKSQSSLQTELSSVPILRDAAWLGAQEGESASSDCGGTSD
LQEPSSVSGEEVEGSETSDITGLEASPGSKGSWGGNQQNGDRTPQESPPPNSETPVTAGA
FSDPLQVPSLSLSDQLRLGREDPNKLGLNVECRICGDKASGFHYGVHACEGCKGFFRRTI
RMKLEYERCERACKVQKKSRNKCQYCRFQKCLALGMSHDAIRYGRMPEAEKKKLVAGLLA
GENPQSSSGADLKTLAKHVNTAYLRNLNMTKKKARSILTGKTSCTAPFVIHDMDSLWQAE
NGLVWNQLNGAPLNKEIGVHVFYRCQCTTVETVRELTEFAKNIPGFVDLFLNDQVTLLKY
GVHEAIFAMLPSLMNKDGLLVANGKGFVTREFLRSLRKPFSEIMEPKFEFAVKFNALELD
DSDLALFVAAIILCGDRPGLMNVKQVEQIQDGILQALDQHLQVHHPDSSHLFPKLLQKMA
DLRQLVTENAQLVQMIKKTESETSLHPLLQEIYKDMY
Download sequence
Identical sequences A9C4A5
ENSDARP00000110137 ENSDARP00000120571 ENSDARP00000110137 7955.ENSDARP00000023084 NP_571543.1.45394 XP_005167044.1.45394 XP_009302202.1.45394 XP_009302203.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]