SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110485 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110485
Domain Number 1 Region: 135-199
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000144
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110485   Gene: ENSDARG00000086319   Transcript: ENSDART00000123922
Sequence length 206
Comment pep:known chromosome:Zv9:11:38674080:38755069:-1 gene:ENSDARG00000086319 transcript:ENSDART00000123922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNEASLEGEGQPGQPGGAVPAAGAPASISAPAGGGQLHKPSNGAPAGGMGTGHGPGMNS
IQGKPNQTDPSMGPKPGGPPGVGPGPGAPTHPQGPSQSQAARKNLQVDVGGSKGGPVSPG
SSAPTSPYSLPQIAPMPSSKLCPVCKTADLTGTTDGQPNCNKCTQCRSMVCNQCGFNPNP
HLTEVQEWLCLNCQMQRALGMDMETP
Download sequence
Identical sequences A0A140LGP1
ENSDARP00000110485 ENSDARP00000110485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]