SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110850 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110850
Domain Number 1 Region: 156-190,217-442
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.27e-71
Family Nuclear receptor ligand-binding domain 0.0000000206
Further Details:      
 
Domain Number 2 Region: 107-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.38e-25
Family Nuclear receptor 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110850   Gene: ENSDARG00000011696   Transcript: ENSDART00000122258
Sequence length 444
Comment pep:known chromosome:Zv9:20:47037237:47068064:-1 gene:ENSDARG00000011696 transcript:ENSDART00000122258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLVQFYHPESFSFPSEQNAFMDMMSFSGHCPPYIKTEPSSPSSLSDSLTQHSPGASSDA
GSSYSSGPKGNLAGLDSPASYLRSAPCRLLEEAQAKGEYGLSSGPKRLCLVCGDVASGFH
YGVASCEACKAFFKRTIQGNIEYSCSVSRDCEITKRRRKSCQACRFTKCLSVGMLREGVR
LDRVRGGRQKYKRRIDSDSSVYLSVPLPHRKPVSCSAHAENKVVTLLLGAEPEKVCAMPD
PALPDSDIKALTTLCDLADRELVLNISWAKHIPGFSSLSLSDQMSLLQSAWMEILVLRVA
FRSLPCDDRLLFADDYIMDAEQAKCAGLLELHTAILQLVRRYRCMSLEREEFVTLKAIAL
ANSDSMHIEDVEAVQGLQDALHEALLDYECVHHSEDPRRAGKLIMTLPLLRQTSAKAVRH
FCSIKQDGRVPMHKLFLELLEANI
Download sequence
Identical sequences Q5RJ38
ENSDARP00000110850 ENSDARP00000091109 XP_005160912.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]