SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111061 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111061
Domain Number 1 Region: 113-127,174-426
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-65
Family Nuclear receptor ligand-binding domain 0.000031
Further Details:      
 
Domain Number 2 Region: 44-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-28
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111061   Gene: ENSDARG00000045904   Transcript: ENSDART00000127099
Sequence length 426
Comment pep:known chromosome:Zv9:25:22997981:23001994:1 gene:ENSDARG00000045904 transcript:ENSDART00000127099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDPMSEMSMVPFSSPTESSRSNSTDDSQDGKSPAPGKVLNTGLLCKVCSDTSSGKHYGI
YACNGCSGFFKRSVRRRLIYRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNE
RQPRSTAQVRLDALDVDKDKEHLATTLEPTSSSTCSVISRPLLGSSISSSISSTDGSQHS
NSPKNGHRFMASLMTAETCAKLEPEDVDENIDVTSNEPERSSPMYGSALYPSREPESVYE
TSARLLFMSVKWAKNLPVFSHLPFRDQVILLEEAWSELFLLCAIQWSLPLDNCPLLSLPD
LSPTGQGKGSPSASDVRVLQEVFSRFKPLQVDPTEFACLKAIVLFKPETRGLKDPEQVEN
LQDQSQVLLAQHIHTLYPSQVARFGRLLLLLPSLHFVSSERIEHLFFQRTIGNTPMEKLL
CDMFKN
Download sequence
Identical sequences F1QGF3
ENSDARP00000111061 ENSDARP00000111061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]