SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111644 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111644
Domain Number 1 Region: 134-412
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-75
Family Nuclear receptor ligand-binding domain 0.00000000296
Further Details:      
 
Domain Number 2 Region: 81-160
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.6e-27
Family Nuclear receptor 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111644   Gene: ENSDARG00000034893   Transcript: ENSDART00000126022
Sequence length 460
Comment pep:known chromosome:Zv9:3:33201407:33312201:-1 gene:ENSDARG00000034893 transcript:ENSDART00000126022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNGNPCPSPGGLGTPLGGFPMPHYPYFFPHMLGGLSPPALPGLPVSGYSTPSPATVET
QSTSSEEIVPSPPSPPPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYT
CHREKSCIINKVTRNRCQYCRLQKCLEVGMSKESVRNDRNKRKKDDKKQECLENYVLSPD
TEKMIEQVRKAHQETFPSLCQLGKYTTNNSADHRVALDVDLWDKFSELSTKCIIKTVEFA
KQLPGFTTLTIADQITLLKAACLDILILRICTRYTPDQDTMTFSDGLTLNRTQMHNAGFG
PLTDLVFAFANQLLPLEMDDAETGLLSAICLLCGDRQDLEQSDKVDELQEPLLEALKIYV
RNRRPHKPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLEGG
GSKGAGGGGGGGGGKGAPPGSCSPSLSPSSAHSSPSAHSP
Download sequence
Identical sequences E7EZ95
ENSDARP00000111644 XP_005164086.1.45394 ENSDARP00000111644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]