SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112360 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000112360
Domain Number 1 Region: 334-576
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.06e-69
Family Nuclear receptor ligand-binding domain 0.0000133
Further Details:      
 
Domain Number 2 Region: 83-173
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-29
Family Nuclear receptor 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112360   Gene: ENSDARG00000009594   Transcript: ENSDART00000127353
Sequence length 578
Comment pep:known chromosome:Zv9:19:19388583:19395415:1 gene:ENSDARG00000009594 transcript:ENSDART00000127353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTKAGGVIAYISSSSSASSPESCHSDSSNSSFQSCSPPHTGQGQGETLHVASHSRPPR
HGGGKARSLSSTKSGITKINGLVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQY
KKCLKNESCPIMRINRNRCQQCRFKKCLLVGMSRDAVRFGRIPKREKQRMLLEMQNAMNN
MMNNSHGNQSLNNQTSAADGTSEDGTSEDSTSGPSSRSPSSSPRSNRSESSPDPELQIAM
DTSSSSDSSSATDSGEEEVIGTVTRAHQETFMYNQEQGSMASEALNNYSHCTEKTQEVLN
HQNNVSSVSEQNPQSSCGPQGPEDSGQDYSTLSSCPVRLSNNSSRGPSLQTLTFRAHNDH
ETHANGSYIVPTFPRANRMHLVCPMNTSPYVDPQKSGHSIWEEFSMSFTPAVREVVEFAK
RIPGFKDLSQHDQVSLLKAGTFEVLVVRFTSLFDVKERKVTFLSGRKYSVDALRSLGAGD
LLNSMFDFTEKLQALNLSEEEMSLFTAVVLVSADRSGLENVNSVEALQETLIRALRSLIT
KNHPNEIAIFTKLLLKLPDLRSLNNMHSEQLLAFKVHP
Download sequence
Identical sequences Q6GMI3
ENSDARP00000112360 NP_571140.1.45394 ENSDARP00000112360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]