SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112686 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000112686
Domain Number 1 Region: 308-374
Classification Level Classification E-value
Superfamily HMG-box 0.000000000011
Family HMG-box 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112686   Gene: ENSDARG00000094059   Transcript: ENSDART00000136033
Sequence length 375
Comment pep:putative chromosome:Zv9:21:20147024:20152703:-1 gene:ENSDARG00000094059 transcript:ENSDART00000136033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFQLLKKNQQENVTNMLQCLNFHQSHIHNQNRRVLSHCLPQYNDKKSESESKDTPPQFMK
AKNMNTYSRINKYTVQLSDNKRDSQTKDCVRFIINAVEELVCNRQSNSSQTQPTEDKESW
PVEDSEASQSSTDSNSTTSSSFTASSRESTCSVQSESEDGSPGRKSLDTPPLGSGIRLKD
PMLGAFPVAWKKHFAFSTTLPKTPVQPLQETESLILNPSLLISPSQGLSCSLFPEGQGAL
ESLFEDVWVTHESTILKSPSSSDSFEHDSESVINVETDRFAFMKNKPKIKDEMPKQLIPL
KKVRKVCPHLHTSRRGRVSTQPNPKKKCVNGFLMFCRINRKLYIRSYPGIPSTTVTKELA
NLWHILPKRERRLYC
Download sequence
Identical sequences F1REC9
ENSDARP00000112686 ENSDARP00000112686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]