SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113554 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113554
Domain Number 1 Region: 335-489
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-26
Family Synaptotagmin-like (S variant) 0.0024
Further Details:      
 
Domain Number 2 Region: 178-311
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.82e-18
Family Synaptotagmin-like (S variant) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113554   Gene: ENSDARG00000010934   Transcript: ENSDART00000140164
Sequence length 500
Comment pep:novel chromosome:Zv9:13:32067613:32089878:-1 gene:ENSDARG00000010934 transcript:ENSDART00000140164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYVNADYHCSSSDSDDEVIGQYQEAVSRSQGLRGGAARTNSRHQKGYGWDTRQKYSPLAA
EYDGYSSEASADDVNCIQRMRRTPPLDELQPPPYQDEDGSPRMSCTPSDLGDAKCDLSHG
SDSPRHSYGKCPSELSGAQETESFLNKGYEEDVPSDSTAVLSPEDLSARGSAAQLPKGYD
PEPLAQYGTLDVVFDYDSSDQRLSISITALTDIPSLKRTGNISWQVHLVLLPTKKQRAKT
IIQRGPCPVFTETFHFSHIESEMIGNYAIRFRLYSVRRMKKEKALGEKVFYLTKLNLQGK
MSVPIILDPYCNIPGSDSQASMSDVSCSETASSYPSAAQGSAPEILLGLVYNATTGRLSV
EVIKGSHFKNLAANKPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSVC
RGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHW
TEMKESKGQQVCRWHSLLES
Download sequence
Identical sequences F1RAD1
ENSDARP00000113554 ENSDARP00000113554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]