SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113692 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113692
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000518
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 2 Region: 141-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113692   Gene: ENSDARG00000093316   Transcript: ENSDART00000132832
Sequence length 750
Comment pep:known chromosome:Zv9:20:35744854:35769585:-1 gene:ENSDARG00000093316 transcript:ENSDART00000132832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKDVDKCLVNPPVCGPNSNCTNTMGSYSCSCLSGFTATNPNLTISIDNICTDINECQPSP
SVCGPNSSCTNEIGSYSCACLNGFTALPSNGTLCQQDINECQQTPSVCGPNSTCTNVIGS
YYCLCLPGFIPANPNLLASINNTCIDINECQPSPSVCGPNSICNNEIGSYSCSCLNGFTP
ANSNLLVSSNNKCTVLENMTMHILTMPGSVFADYTISATSSNLDFSSANAALSSSLQAQG
IILAADAFAQSGKDIPCLILNPSHVLNASCLLCYMGLWQNIAVKQLPNINFLFLTSVVTS
LKLSYVVKSDNNINITQSAATVKAIVDILSQIANLAQTALIGPPVMNLSRTTVNSSLSVT
STLSNSTTEIVIPQVFGPTTATIIIFTTLDNILPTRNISNNNSSDISDQRINGDVVVVKV
DKTVNNISFAFDITNQSLGNPQCVFWNFNLSAWDSTGCEVKQVGNDSGIITCECNHTTSF
SILMSPFILDSLILAYITYIGVTISMISLVLCLIIEAIVWRSVTSARVNIALSLLIANVC
FIIGAAISDLEKPTPVGRCSPVVFFIHFFYLAVFFWMLISGMLLLYMTVMVFGQMSRIKM
IAISFPVGYGAPLLIASITVASTAGPQNYVSKQACWLNWNESRALLAFVIPALTIVAINL
VVLVVVLYKMLGTGVGAATQPSEKNTFFVVVRCVAFLTPLFGLTWGFGIGTMLSSALGVH
VLFTLLNAFQGFFILLFGTILDAKVREALR
Download sequence
Identical sequences ENSDARP00000113692 ENSDARP00000113692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]