SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000114062 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000114062
Domain Number 1 Region: 13-123
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.62e-33
Family MBT repeat 0.00047
Further Details:      
 
Domain Number 2 Region: 346-444
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.2e-26
Family MBT repeat 0.00085
Further Details:      
 
Domain Number 3 Region: 256-386
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.64e-26
Family MBT repeat 0.00093
Further Details:      
 
Domain Number 4 Region: 122-226
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.52e-21
Family MBT repeat 0.00021
Further Details:      
 
Domain Number 5 Region: 784-856
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.48e-17
Family SAM (sterile alpha motif) domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000114062   Gene: ENSDARG00000045519   Transcript: ENSDART00000142992
Sequence length 861
Comment pep:known chromosome:Zv9:4:24388107:24446167:1 gene:ENSDARG00000045519 transcript:ENSDART00000142992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XASMDCGEEEVDFNWEEYLEDTGATAAPHTSFRHVELSLQSSFQPGMKLEVANKGSVDTY
WVATIITTCGQLLLLRYCGYGEDRKADFWCDVMTAELHPVGWCAQNDKTLQPPEAIKEKY
SDWTEFLIKELTGSRTAPANLLEGPLRGKNTVDLIMEGSILELRDASEPSVYWATQVQRN
VGGRLCLSYVGLNDPSYYMWMFYLDTRLRPLGWAKENNLPMKPPTDLCDLRSSSEWTTAL
DEATAEALNNPLPLEVFKDHADLHTHSFRAGMKLEMVSPVEPFHICPVSVTKVYNEYHFQ
ITVDDLTADATPTSAVCHAESPGILPVQWCLKNGVELERPRGFETQDFDWADYLKHTSTE
AAPDACFPNASQSRGFCKDMWLEAVNPLHPAELCVARITQVKGCLLWLRLEGLTKPLPDC
IVDVESMNIFPVGWCEANGYPLTHSLKTVCLPQKKIAVVQPEKHLWKSHTIFILFPLHHD
LCLSKVRAYCLVNGKYCCSQLFINHRCFSGPYLNKGRIAELPKAVGPGKCAVVLKEILTM
LINSAYKPGRVLRELQMVEDPQWNCQEETLKAKYKGKSYRSTMRIVRTADQVSEFCRRVC
ERLQCCLNLFGPTFVSDKCPENCSSQTKTKYTYYKKRKVGRPSLGENAQDGDLSKPARRR
KKRKAIFVQKKRRSSIVGYHTTESPQDSDYNYDEDEDEDFEEWGSEASSSSLREEASAHN
SLPRRGRPPRRAALQRRMTHPGSETSDRISPRRTTRSVSYSQNQMARDTNVKMESTEEED
RLVLDTNPLQWSVSDVVDFITSTDCASLAKIFQEQDIDGQALLLLTLPTVQECMDLKLGP
AIKLCHQIERVKVAFYSQYAN
Download sequence
Identical sequences F1QXQ3
ENSDARP00000114062 ENSDARP00000114062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]